current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|Q96KD3|F71F1_HUMAN Protein FAM71F1 OS=Homo sapiens GN=FAM71F1 PE=2 SV=1, from NEW_HUMAN_DOMAINS

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
# Score Template Links and tools%idFirst MLSSFPHRKTWRKSKKTVKVTRSYPTFPSLNAWEEFRGLLPVDGEPNPGAGLGVEEGLLCRVVHSPEFNLFLDSVVFESNFIQVKRGRNWRDVYKASNTMALGVTSSVPCLPLPNILLMASVKWHQGQNQTWNRPSILast
1 -83.100sp|Q96KD3|F71F1_HUMAN Protein FAM71F1 OS=Homo sapiens GN=FAM71F1 PE=2 SV=1  ali  100  1MLSSFPHRKTWRKSKKTVKVTRSYPTFPSLNAWEEFRGLLPVDGEPNPGAGLGVEEGLLCRVVHSPEFNLFLDSVVFESNFIQVKRGRNWRDVYKASNTMALGVTSSVPCLPLPNILLMASVKWHQGQNQTWNRPSI 137
2 -53.800sp|Q6NXP2|F71F2_HUMAN Protein FAM71F2 OS=Homo sapiens GN=FAM71F2 PE=2 SV=3  ali   67  1......................................................ENGLLCQLIHSPEFNLFSNSVVFESNFIQVTKPGNWRDVCEGSATVILGVTSSVPSLPLPNVLLMANVTWPQGPFTTWSTPG. 91
3 -53.500sp|Q8IYT1|FA71A_HUMAN Protein FAM71A OS=Homo sapiens GN=FAM71A PE=2 SV=2  ali   24  1................................MNADFLLPYYTAQSGSSMSMNTTMGKLQRQLYKGEYDIFKYAPIFESDFIQITKRGEVIDVHNRVRMVTMGIARTSPILPLPDVMLLAR................ 90
4 -53.100sp|Q8N5Q1|F71E2_HUMAN Protein FAM71E2 OS=Homo sapiens GN=FAM71E2 PE=5 SV=3  ali   31  21.....................................................PVLGELQKTLQKGEYLPLRPLPMFESNFVQVTHQGGPVFVNHRTNRLAMGVAASLPGLVLPDILLIGQPAEDR........... 93
5 -48.900sp|Q8TC56|FA71B_HUMAN Protein FAM71B OS=Homo sapiens GN=FAM71B PE=1 SV=2  ali   32  23.....................................................TSMGDLQRQLNRGEYNIFKYAPMFESNFIQINKKGEVIDVHNRVRMVTVGIVCTSPILPLPDVMVLA................. 90
6 -47.500sp|Q8NEG0|FA71C_HUMAN Protein FAM71C OS=Homo sapiens GN=FAM71C PE=2 SV=1  ali   31  1.....................................................TSMGKLQRQLYKGEYTIFRYAPMFESDFIQISKRGEVIDVHNRARMVTMGIVRTSPCLTLPDVMLLA................. 67
7 -45.600sp|Q6IPT2|F71E1_HUMAN Protein FAM71E1 OS=Homo sapiens GN=FAM71E1 PE=2 SV=2  ali   35  2.........................................................RLQRYLQSGEFDQFRDFPIFESNFVQFCPDIQVTRLGEVANEVTMGVAASSPALELPDLLLLAGPAK............. 78
8 -45.500sp|Q8N9W8|FA71D_HUMAN Protein FAM71D OS=Homo sapiens GN=FAM71D PE=2 SV=2  ali   28  1..........................................................LQNMLDGGEYAPFVSPPMLESNFIQVNRRGESIYLHNRANWVTVGICFSSSTHKIPNVMLLAH................ 63
9 -26.600tr|C9K0C0|C9K0C0_HUMAN Uncharacterized protein OS=Homo sapiens GN=FAM71F2 PE=4 SV=1  ali   60  1................................MSKIRGLPPEVREPGPGVELGVENGLLCQLIHSPEFNLFSNSVVFESNFIQVTKPGNWRDVCEGSATVI.................................... 78
10 -6.350sp|Q9H7D0|DOCK5_HUMAN Dedicator of cytokinesis protein 5 OS=Homo sapiens GN=DOCK5 PE=1 SV=3  ali   16  27...................................................................YDPDQSTFISENYLIRWGSNGMPKEIEKLNNLQAVFTDLSSMDLIRPRVSLVCQIV.............. 82

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 7 0 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.