current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|Q96L50|LLR1_HUMAN Leucine-rich repeat protein 1 OS=Homo sapiens GN=LRR1 PE=1 SV=2 (Range: 354-414), from NEW_HUMAN_DOMAINS

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60
# Score Template Links and tools%idFirst AKICVCGRFCLNSFIQGTTTMNLHSVAHTVVLVDNLGGTEAPIISYFCSLGCYVNSSDMLKLast
1 -46.200sp|Q96L50|LLR1_HUMAN Leucine-rich repeat protein 1 OS=Homo sapiens GN=LRR1 PE=1 SV=2 (Range: 354-414)  ali  100  1AKICVCGRFCLNSFIQGTTTMNLHSVAHTVVLVDNLGGTEAPIISYFCSLGCYVNSSDMLK 61
2 -11.400sp|Q6ZNQ3|LRC69_HUMAN Leucine-rich repeat-containing protein 69 OS=Homo sapiens GN=LRRC69 PE=2 SV=2 (Range: 283-347)  ali follow..  15  4GKTCICGQYFITVWLECVRFVPPPKDWKI-----SKNLKLVPLQVLICSYKCFTQ...... 54
3 -9.730tr|B4DHL3|B4DHL3_HUMAN Uncharacterized protein OS=Homo sapiens GN=LRRC28 PE=2 SV=1 (Range: 207-298)  ali follow..  15  38GHCHRCSEPMFT-----IVYPKLFPLRETPMAGLHQWKTTVSFVAYCCSTQCLQTFD.... 89
4 -9.730sp|Q86X40|LRC28_HUMAN Leucine-rich repeat-containing protein 28 OS=Homo sapiens GN=LRRC28 PE=2 SV=1 (Range: 276-367)  ali follow..  15  38GHCHRCSEPMFT-----IVYPKLFPLRETPMAGLHQWKTTVSFVAYCCSTQCLQTFD.... 89
5 -6.120tr|E9PNR1|E9PNR1_HUMAN Uncharacterized protein OS=Homo sapiens GN=OSBPL9 PE=4 SV=1 (Range: 1-72)  ali follow..  24  2......................VESIKHCIVLLQIAKSTINPVDAIY.............. 26
6 -5.320sp|Q96K49|TM87B_HUMAN Transmembrane protein 87B OS=Homo sapiens GN=TMEM87B PE=1 SV=1 (Range: 43-173)  ali follow..  17  23..................TMFNSTDIKLSVKSFHCSGPVKFTIVWHLKYHTCHNEHSNL.. 63
7 -5.000sp|Q13017|RHG05_HUMAN Rho GTPase-activating protein 5 OS=Homo sapiens GN=ARHGAP5 PE=1 SV=2 (Range: 556-656)  ali follow..  10  2...CLSGQNCTDIKVEQLLASSLLQLDHGRLRLYHDSTNIDKVNLFILGKD.......... 49
8 -5.000sp|Q8NFP9|NBEA_HUMAN Neurobeachin OS=Homo sapiens GN=NBEA PE=1 SV=3 (Range: 1525-1582)  ali follow..  18  11...........DRLLQDVDINRLRAVVFRDVDDSKQAQFLALAVVYFISVLMVSKYRDI.. 58
9 -4.900sp|Q6UWI4|SHSA2_HUMAN Protein shisa-2 homolog OS=Homo sapiens GN=SHISA2 PE=1 SV=1 (Range: 199-295)  ali follow..  14  6TNCCLPEGTMNNVYVNMPTNFSVLNCQQATQIVPHQGQYLHP................... 47
10 -4.840sp|A0PJX8|TMM82_HUMAN Transmembrane protein 82 OS=Homo sapiens GN=TMEM82 PE=2 SV=2 (Range: 97-285)  ali follow..  19  1..................LEFSLRAVSTLLSLGKGSQGAAERLQLYLCGLTCGLSFLQEG. 49

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 4 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Godzik A. Fold recognition methods. Methods Biochem Anal. 2003;44:525-46. Review.