current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|Q96RL7|VP13A_HUMAN Vacuolar protein sorting-associated protein 13A OS=Homo sapiens GN=VPS13A PE=1 SV=2, from NEW_HUMAN_DOMAINS

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# Score Template Links and tools%idFirst LDINIKAPVVVIPQSPVSENVFVADFGLITMTNTFHMITESQSSPPPVIDLITIKLSEMRLYRSRFINDAYQEVLDLLLPLNLEVVVERNLCWEWYQEVPCFNVNAQLKPMEFILSQEDITTIFKTLHLast
1 -64.400sp|Q96RL7|VP13A_HUMAN Vacuolar protein sorting-associated protein 13A OS=Homo sapiens GN=VPS13A PE=1 SV=2  ali  100  1LDINIKAPVVVIPQSPVSENVFVADFGLITMTNTFHMITESQSSPPPVIDLITIKLSEMRLYRSRFINDAYQEVLDLLLPLNLEVVVERNLCWEWYQEVPCFNVNAQLKPMEFILSQEDITTIFKTLH 128
2 -60.200sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1  ali   39  3INIDLKAPVIVIPQSSISTNAVVVDLGLIRVHNQFSLVSDEDYLNPPVIDRMDVQLTKLTLYRTVIQPGIYHPDIQLLHPINLEFLVNRNLAASWYHKVPVVEIKGHLDSMNVSLNQEDLNLLFRILT 130
3 -59.100sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1  ali   40  4MDINLKAPVIIIPQSSVSPNAVIADLGLIRVENKFSLVPMEHYSLPPVIDKMNIELTQLKLSRTILQASLPQNDIEILKPVNMLLSIQRNLAAAWYVQIPGMEIKGKLKPMQVALSEDDLTVLMKIL. 130
4 -27.900sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=1  ali   2............................................STKMYERYSLSFMDLQIMVGRVKDNWKVGPTHVVEKFNVHLQLERRLIYTSDPKYPGAVLSGNLPDLKIHINEDKISALKNC.. 89
5 -26.800sp|Q96RL7|VP13A_HUMAN Vacuolar protein sorting-associated protein 13A OS=Homo sapiens GN=VPS13A PE=1 SV=2  ali  15  1.............................................DRAYDSFDIQLTSVQLLYSRVGDNWRESTQHILVPMHFNLELSKAMVFM-DVRMPKFKIYGKLPLISLRISDKKLQGIMELIE 88
6 -26.000sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1  ali   13  2.............................................DKAYDKFDVEIKNVQLLFARAEETWKPSTMHILQPMDIHVELAKAMVEK-DIRMARFKVSGGLPLMHVRISDQKMKDVLYLMN 89
7 -17.000sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=1  ali   29  100VRLDISAPQVIFPDDFKFKNLVVVDLGRMLL................................................................................................. 132
8 -15.600sp|Q7Z7G8|VP13B_HUMAN Vacuolar protein sorting-associated protein 13B OS=Homo sapiens GN=VPS13B PE=1 SV=2  ali   10VNIVINNLILKYVEDDIVLSVNITSAECYTVGELWDRAFMDISATDLVLRKV-INFSDCTVCLDKRNASGKIEFYQLLYKCSFRTRLHFTYENLNSKMPSVIKIHTLVESLKLSITDQQLPMFIRIMQ 138
9 -15.300sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1  ali   13  3............................................................................IFQPISASAKLYMNPYAESELKTPKLDCNIEIQNIAIELTKPQYLSMIDLLE 54
10 -12.700sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=1  ali   12  11IELKIQDVHLRFEDGVTNPSAFGICIKNVSMQNA------VNEPVQKLMRKKQLDVAEFSIYEAMARSMESRSHHYVLEPVFALLKRNCSKKPLRSRHSPRIDCDIQLETIPLKLSQLQYRQIMEFLK 154
11 -11.100sp|Q7Z7G8|VP13B_HUMAN Vacuolar protein sorting-associated protein 13B OS=Homo sapiens GN=VPS13B PE=1 SV=2  ali   11  16.KISVQTTQIVISMETVPHT-LLASLSNLNGSLSVKATQKVPGIILGS--SFLLSINDFLLKTSL-----KERSRILIGPCCATANLEAK-NPGPEQSIPKISIDLRGGLLQVFWGQEHLNCLVLLHE 143
12 -10.600sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1  ali   14  2LKAMITDPEVVFVASLTKADAPAL----ASFQCNLSLSTSKLE------QMMEASVRDLKVLACPFLREKRGKITTVLQPCSLFMEKCTWASGK-------QNINIMVKEFIIKISPIILNTVLTIM. 113
13 -10.200sp|Q96RL7|VP13A_HUMAN Vacuolar protein sorting-associated protein 13A OS=Homo sapiens GN=VPS13A PE=1 SV=2  ali  13  1..VIIKNPEIVFVADMTKNDAPAL----ITTQCEICYKGNLEN------STMTAAIKDLQVRACPFLPVKRKGKTTVLQPCDLFYQTTQKGTDP-------QVIDMSVKSLTLKVSPVIINTMITI.. 109

FFAS is supported by the NIH grant R01-GM087218-01
1 3 2 7 5 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Doctor KS, Reed JC, Godzik A., Bourne PE. The apoptosis database. Cell Death Differ. 2003 Jun;10(6):621-33. Review.