current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|Q9H7S9|ZN703_HUMAN Zinc finger protein 703 OS=Homo sapiens GN=ZNF703 PE=1 SV=1 (Range: 537-590), from NEW_HUMAN_DOMAINS

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50
1 -42.800sp|Q9H7S9|ZN703_HUMAN Zinc finger protein 703 OS=Homo sapiens GN=ZNF703 PE=1 SV=1 (Range: 537-590)  ali  100  1PHTLGLSRYHPYGKSHLSTAGGLAVPSLPTAGPYYSPYALYGQRLASASALGYQ 54
2 -5.560sp|Q9C0H9|SRCN1_HUMAN SRC kinase signaling inhibitor 1 OS=Homo sapiens GN=SRCIN1 PE=1 SV=3 (Range: 257-307)  ali follow..  47  10...............................GLYADPYGLLHERLSLAAAAG.. 31
3 -5.550tr|B4DZ31|B4DZ31_HUMAN Uncharacterized protein OS=Homo sapiens GN=C12orf48 PE=2 SV=1 (Range: 1-120)  ali follow..  21  57..TVSLSDVLLTWKYLLHEKLNLPVENMDVTDHYEDVRKIYDDFLKNSNMLDL. 107
4 -5.440sp|Q5JSL3|DOC11_HUMAN Dedicator of cytokinesis protein 11 OS=Homo sapiens GN=DOCK11 PE=1 SV=2 (Range: 372-426)  ali follow..  12  22..............................VEPFFINLALFDVKNNCKISADFH 45
5 -5.150tr|E7EQH6|E7EQH6_HUMAN Uncharacterized protein OS=Homo sapiens GN=C3orf17 PE=4 SV=1 (Range: 153-227)  ali follow..  23  37.................................FLGNKLLKSNRLKHLEAQGTS 57
6 -5.150sp|Q6NW34|CC017_HUMAN Uncharacterized protein C3orf17 OS=Homo sapiens GN=C3orf17 PE=1 SV=3 (Range: 356-430)  ali follow..  23  37.................................FLGNKLLKSNRLKHLEAQGTS 57
7 -5.130sp|Q96BY6|DOC10_HUMAN Dedicator of cytokinesis protein 10 OS=Homo sapiens GN=DOCK10 PE=1 SV=3 (Range: 393-452)  ali follow..  20  28..............................IEPFFVSVALYDLRDSRKISADFH 51
8 -4.990sp|Q8TD43|TRPM4_HUMAN Transient receptor potential cation channel subfamily M member 4 OS=Homo sapiens GN=TRPM4 PE=1 SV=1 (Range: 953-1014)  ali follow..  50  15.................................FYRPYQIFGQ........... 25
9 -4.940sp|Q9BZ29|DOCK9_HUMAN Dedicator of cytokinesis protein 9 OS=Homo sapiens GN=DOCK9 PE=1 SV=2 (Range: 364-423)  ali follow..  29............................TNVEPFFVTLSLFDIKYNRKISADFH 54
10 -4.830sp|Q8NF50|DOCK8_HUMAN Dedicator of cytokinesis protein 8 OS=Homo sapiens GN=DOCK8 PE=1 SV=3 (Range: 238-312)  ali follow..  16  43.............................EIEPLFASIALYDVKERKKISENFH 67

FFAS is supported by the NIH grant R01-GM087218-01
1 2 8 5 9 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zmasek CM, Zhang Q, Ye Y, Godzik A. Surprising complexity of the ancestral apoptosis network. Genome Biol. 2007 Oct 24;8(10):R226 [Epub ahead of print]