current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|Q9HAT2|SIAE_HUMAN Sialate O-acetylesterase OS=Homo sapiens GN=SIAE PE=1 SV=1 (Range: 19-108), from NEW_HUMAN_DOMAINS

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90
# Score Template Links and tools%idFirst DRSAGIGFRFASYINNDMVLQKEPAGAVIWGFGTPGATVTVTLRQGQETIMKKVTSVKAHSDTWMVVLDPMKPGGPFEVMAQQTLEKINFLast
1 -58.400sp|Q9HAT2|SIAE_HUMAN Sialate O-acetylesterase OS=Homo sapiens GN=SIAE PE=1 SV=1 (Range: 19-108)  ali  100  1DRSAGIGFRFASYINNDMVLQKEPAGAVIWGFGTPGATVTVTLRQGQETIMKKVTSVKAHSDTWMVVLDPMKPGGPFEVMAQQTLEKINF 90
2 -5.850sp|Q96JI7|SPTCS_HUMAN Spatacsin OS=Homo sapiens GN=SPG11 PE=1 SV=3 (Range: 261-390)  ali follow..  16SSNSAVALNLNLYFRGHLLCERILEDLPIQGPKGVDEDDPVNSAYNMKLAKFSFQI----DRSWKAQLSSL................... 85
3 -5.110sp|Q9HBM0|VEZA_HUMAN Vezatin OS=Homo sapiens GN=VEZT PE=1 SV=3 (Range: 60-149)  ali follow..  11  28.DIGFRLDSLHTILQQEVLLQEDVELIELLD-----SILSAGQSQQQENGHLPTLCSLATPNIWDLSM...................... 90
4 -5.100sp|Q8N398|VW5B2_HUMAN von Willebrand factor A domain-containing protein 5B2 OS=Homo sapiens GN=VWA5B2 PE=2 SV=2 (Range: 79-157)  ali follow..  20  25..............QGHLVLDLAQARSTL-GIIAAAGTMTVTLH-------SSRELPSRPDGVLHVALPTV................... 77
5 -5.020sp|Q6BDS2|URFB1_HUMAN UHRF1-binding protein 1 OS=Homo sapiens GN=UHRF1BP1 PE=1 SV=1 (Range: 309-398)  ali follow..  1........RLSQYFEKFDVKESSYHLLI--------SRLDLHICDDSQSREPGVSANRLMGGAMQLTFRKMAFD-PFHWAGDSCKH.... 71
6 -4.830sp|Q9NS62|THSD1_HUMAN Thrombospondin type-1 domain-containing protein 1 OS=Homo sapiens GN=THSD1 PE=1 SV=1 (Range: 23-172)  ali follow..  10..............PGHVALSNDTVYVDF-NGTLRNVSVLLLEANTNQTVTTKYLLTNQSQGTLKFECFYFKEAGDYWFTMTPEATD... 87
7 -4.700tr|B3KUS9|B3KUS9_HUMAN Uncharacterized protein OS=Homo sapiens GN=C3orf22 PE=4 SV=1 (Range: 1-102)  ali follow..  17  53..............TVQLPLQKRLVPTR----SIPVRGVGVRIKKSMNVTSRTLSQMYTHTGKWA......................... 99
8 -4.680sp|O00110|OVL2L_HUMAN Putative transcription factor Ovo-like 2-like OS=Homo sapiens PE=5 SV=2 (Range: 1-61)  ali follow..  11  1.........MPRAF----LVRSRRPQPPNWGHLPDQLRGDAYIPGGPLTVPGGKGQERRSVTIWLFSSDCSSLG................ 61
9 -4.620sp|Q99941|ATF6B_HUMAN Cyclic AMP-dependent transcription factor ATF-6 beta OS=Homo sapiens GN=ATF6B PE=1 SV=2 (Range: 1-85)  ali follow..  10  14..........TRFFTDNLLSPED------WGLQNSTSGLDEVAEEQTQLFRCPEQDVPFDGSSLDVGMDVSPSEPPWE............ 77
10 -4.510sp|Q5VU92|DC121_HUMAN DDB1- and CUL4-associated factor 12-like protein 1 OS=Homo sapiens GN=DCAF12L1 PE=2 SV=1 (Range: 398-463)  ali follow..  12..............................GWLNHNDFWVNYFGGMEVFPNALYTHCYNWPE-----MKLFVAGGPLPAGLHGNYAGL.. 64

FFAS is supported by the NIH grant R01-GM087218-01
1 2 8 5 9 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zmasek CM, Zhang Q, Ye Y, Godzik A. Surprising complexity of the ancestral apoptosis network. Genome Biol. 2007 Oct 24;8(10):R226 [Epub ahead of print]