current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|Q9NR09|BIRC6_HUMAN Baculoviral IAP repeat-containing protein 6 OS=Homo sapiens GN=BIRC6 PE=1 SV=2 (Range: 3663-3721), from NEW_HUMAN_DOMAINS

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .
# Score Template Links and tools%idFirst KLRRHHVPQQCNKMPITADLVAPILRFLTEVGNSHIMKDWLGGSEVNPLWTALLFLLCHLast
1 -44.400sp|Q9NR09|BIRC6_HUMAN Baculoviral IAP repeat-containing protein 6 OS=Homo sapiens GN=BIRC6 PE=1 SV=2 (Range: 3663-3721)  ali  100  1KLRRHHVPQQCNKMPITADLVAPILRFLTEVGNSHIMKDWLGGSEVNPLWTALLFLLCH 59
2 -5.800tr|E9PJL5|E9PJL5_HUMAN Uncharacterized protein OS=Homo sapiens GN=C12orf63 PE=4 SV=1 (Range: 575-671)  ali follow..  13  20........TAPQDVQPDKEIVVDTIMFLWQKCKLGIQRLNISRNDYAKFWIYLLWQINE 78
3 -5.800sp|Q96N23|CL055_HUMAN Uncharacterized protein C12orf55 OS=Homo sapiens GN=C12orf55 PE=2 SV=2 (Range: 575-671)  ali follow..  13  20........TAPQDVQPDKEIVVDTIMFLWQKCKLGIQRLNISRNDYAKFWIYLLWQINE 78
4 -5.660sp|Q49A92|CH034_HUMAN Uncharacterized protein C8orf34 OS=Homo sapiens GN=C8orf34 PE=1 SV=2 (Range: 131-204)  ali follow..  14  18KKLGKALENLSRSIAISDELDKETVTFNSSLLRPRVIGEWIGREENDA........... 65
5 -5.650sp|A0PJX8|TMM82_HUMAN Transmembrane protein 82 OS=Homo sapiens GN=TMEM82 PE=2 SV=2 (Range: 97-285)  ali follow..  20  99.......AHAHGLPQLLGRALAIAFAVGDLAAVALINQDFLTTSEAMRFWTPLT--ICY 148
6 -5.410tr|C9JNM7|C9JNM7_HUMAN Uncharacterized protein OS=Homo sapiens GN=NPHP1 PE=4 SV=1 (Range: 489-570)  ali follow..  13  27..............LIGNMCSIHLLIFYRQILGDVLLKDRMSLQSTDLISHPMLATF.. 69
7 -5.290sp|Q9H2M9|RBGPR_HUMAN Rab3 GTPase-activating protein non-catalytic subunit OS=Homo sapiens GN=RAB3GAP2 PE=1 SV=1 (Range: 376-434)  ali follow..  16  10RHGESICLSPCNTLAAVTDDFGRVI--LLDVARGIAIRMWKGYRDAQIGW......... 57
8 -5.210sp|Q2PPJ7|RGPA2_HUMAN Ral GTPase-activating protein subunit alpha-2 OS=Homo sapiens GN=RALGAPA2 PE=1 SV=2 (Range: 493-570)  ali follow..  18  46................QVDACKAVLIIFRRMIMELTMN--------KKTWEQMLQIL.. 78
9 -4.990sp|Q6GYQ0|RGPA1_HUMAN Ral GTPase-activating protein subunit alpha-1 OS=Homo sapiens GN=RALGAPA1 PE=1 SV=1 (Range: 518-593)  ali follow..  21  37................HTDMCKRILNIYRYMVVQVSMD--------KKTWEQMLLVL.. 69
10 -4.980sp|Q96RT8|GCP5_HUMAN Gamma-tubulin complex component 5 OS=Homo sapiens GN=TUBGCP5 PE=1 SV=1 (Range: 206-269)  ali follow..  26  3................................DEPDDRSWLEHHVVHQYWT........ 21

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 4 6 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Godzik A. Fold recognition methods. Methods Biochem Anal. 2003;44:525-46. Review.