current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|Q9ULV3|CIZ1_HUMAN Cip1-interacting zinc finger protein OS=Homo sapiens GN=CIZ1 PE=1 SV=2 (Range: 100-174), from NEW_HUMAN_DOMAINS

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .
# Score Template Links and tools%idFirst FAMPPATYDTAGLTMPTATLGNLRGYGMASPGLAAPSLTPPQLATPNLQQFFPQATRQSLLGPPPVGVPMNPSQFLast
1 -58.400sp|Q9ULV3|CIZ1_HUMAN Cip1-interacting zinc finger protein OS=Homo sapiens GN=CIZ1 PE=1 SV=2 (Range: 100-174)  ali  100  1FAMPPATYDTAGLTMPTATLGNLRGYGMASPGLAAPSLTPPQLATPNLQQFFPQATRQSLLGPPPVGVPMNPSQF 75
2 -6.340sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=2 (Range: 3659-4143)  ali follow..  10  155ITVPESQLTVSQFTLPKSVSDGIAALDLNAVANKIADFELPTIIVPEQTIEIPSIK................... 210
3 -5.890sp|Q8TC92|ENOX1_HUMAN Ecto-NOX disulfide-thiol exchanger 1 OS=Homo sapiens GN=ENOX1 PE=1 SV=1 (Range: 1-106)  ali follow..  22  41...........SVTDPTAWATAMNNLGMVPVGLPGQQLVSDSICVPGFDPSLNMMTGITPINPMIPGLGLVPP.. 102
4 -5.760sp|Q5RHP9|CA173_HUMAN Uncharacterized protein C1orf173 OS=Homo sapiens GN=C1orf173 PE=2 SV=1 (Range: 1-84)  ali follow..  17  1...........................MSHSHPAGLLAAYNSLMDKHLAGYFNNTRIRRHL.............. 34
5 -5.750tr|F5H7W1|F5H7W1_HUMAN Uncharacterized protein OS=Homo sapiens GN=DCAF17 PE=4 SV=1 (Range: 1-453)  ali follow..  21  193FRVLPFSL-VGILEINKKIFGNVTDATLSH-GILIVMYSSGLVRLYSFQTIAEQFMQQKLVGEAPFGIPCN.... 275
6 -5.470sp|Q96FG2|ELMD3_HUMAN ELMO domain-containing protein 3 OS=Homo sapiens GN=ELMOD3 PE=2 SV=2 (Range: 102-154)  ali follow..  24  24.............................................PTIRRTGLAALRHYLFGPPKLHQRLREER. 52
7 -5.150sp|Q9Y4W2|LAS1L_HUMAN Protein LAS1 homolog OS=Homo sapiens GN=LAS1L PE=1 SV=2 (Range: 449-509)  ali follow..  22  11.....................SLDWPRMVESCLGSPCWASPRIIFKAMGQGLPDEEQEKLL.............. 53
8 -5.090sp|Q6QNK2|GP133_HUMAN Probable G-protein coupled receptor 133 OS=Homo sapiens GN=GPR133 PE=2 SV=1 (Range: 283-362)  ali follow..  27  18...........................LQNVSLSLPSKSLSEQTALNLTKTFLKAVGEILLLP............ 53
9 -5.050sp|Q5H9S7|DCA17_HUMAN DDB1- and CUL4-associated factor 17 OS=Homo sapiens GN=DCAF17 PE=1 SV=1 (Range: 1-520)  ali follow..  19  193FRVLPFSL-VGILEINKKIFGNVTDATLSH-GILIVMYSSGLVRLYSFQTIAEQFMQQGTVGEAPFGIPCN.... 275
10 -5.050tr|F8WEC1|F8WEC1_HUMAN Uncharacterized protein OS=Homo sapiens GN=ELMOD3 PE=4 SV=1 (Range: 33-84)  ali follow..  24  16.............................................PTIRRTGLAALRHYLFGPPKLHQRLREER. 44

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 5 6 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82.