current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|Q9Y236|OSGI2_HUMAN Oxidative stress-induced growth inhibitor 2 OS=Homo sapiens GN=OSGIN2 PE=2 SV=1, from NEW_HUMAN_DOMAINS

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst MPLVEETSLLEDSSVTFPVVIIGNGPSGICLSYMLSGYRPYLSSEAIHPNTILNSKLEEARHLSIVDQDLEYLSEGLEGRSSNPVAVLFDTLLHPDADFGYDYPSVLast
1 -70.900sp|Q9Y236|OSGI2_HUMAN Oxidative stress-induced growth inhibitor 2 OS=Homo sapiens GN=OSGIN2 PE=2 SV=1  ali  100  1MPLVEETSLLEDSSVTFPVVIIGNGPSGICLSYMLSGYRPYLSSEAIHPNTILNSKLEEARHLSIVDQDLEYLSEGLEGRSSNPVAVLFDTLLHPDADFGYDYPSV 106
2 -7.180sp|Q6ZQQ6|WDR87_HUMAN WD repeat-containing protein 87 OS=Homo sapiens GN=WDR87 PE=2 SV=3  ali   19  11......................GLNPYQILRYYFGHGREWLFAPDCYIPNSVIRARLWPEGTPIYLQCNLHAPQRELEWDRSQEF..................... 73
3 -5.750sp|Q53FE4|CD017_HUMAN Uncharacterized protein C4orf17 OS=Homo sapiens GN=C4orf17 PE=2 SV=3  ali   20  2........................................FLVRHTPHPRRVCH----------------------IKGLNNIPICTVNDD............... 30
4 -5.600sp|Q8NAX2|CA172_HUMAN Uncharacterized protein C1orf172 OS=Homo sapiens GN=C1orf172 PE=2 SV=2  ali   13  23.................................................DVLIFKKLTELFSVHQIDELAKCTSDTVFLEKTSKISDLISSITQ............ 67
5 -5.410sp|Q9BRP7|FDXA1_HUMAN Ferredoxin-fold anticodon-binding domain-containing protein 1 OS=Homo sapiens GN=FDXACB1 PE=2 SV=3  ali   15  13.............................ALNHIFTRSLPFEGSQPRIFRIKLGNQWFSFPEPEALVGKLN--RGFLEAPSCHPIKTINEKLIA............ 75
6 -4.700sp|Q6ZP01|RBM44_HUMAN RNA-binding protein 44 OS=Homo sapiens GN=RBM44 PE=2 SV=2  ali   23  14............................................................SESKLKKESLTPLSSELDPEVQKKEEVFFNILEHQDKTVGLE.... 55
7 -4.600tr|E7ETZ9|E7ETZ9_HUMAN Uncharacterized protein OS=Homo sapiens GN=ANKLE1 PE=4 SV=2  ali   18  104.......................EGVVKSSFTYLL------LDPRETQDLPARAFSLTPAERLQTFIRAIFYVGK---GTRARPYVHLWEA............... 162
8 -4.540sp|Q6WRI0|IGS10_HUMAN Immunoglobulin superfamily member 10 OS=Homo sapiens GN=IGSF10 PE=1 SV=1  ali   18  6MVPATKALNLPARTVTADSRTISDSP----MTNINYGT-PVVNSQILPPEEPTDFKLSTAIKTTAMSKNINTMSSQIQGTTNQHSSTVFPLL.............. 96
9 -4.540sp|Q96M53|SPATL_HUMAN Protein SPATIAL OS=Homo sapiens GN=SPATIAL PE=2 SV=3  ali   21  1.....................................HHSFFSRHHPHPQHVTH----------------------IQDLTGKPVCVVRDF............... 32
10 -4.530sp|Q86VH4|LRRT4_HUMAN Leucine-rich repeat transmembrane neuronal protein 4 OS=Homo sapiens GN=LRRTM4 PE=2 SV=2  ali   22  5..........PTNSETMDISVNGSGPCTYTISGSRECEMPH................................................................. 35

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 2 1 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Berman HM, Burley SK, Chiu W, Sali A, Adzhubei A, Bourne PE, Bryant SH,Dunbrack RL Jr, Fidelis K, Frank J, Godzik A, Henrick K, Joachimiak A, HeymannB, Jones D, Markley JL, Moult J, Montelione GT, Orengo C, Rossmann MG, Rost B,Saibil H, Schwede T, Standley DM, Westbrook JD. Outcome of a workshop on archiving structural models of biological macromolecules. Structure. 2006 Aug;14(8):1211-7.