current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|A0AUZ9|CB067_HUMAN Uncharacterized protein C2orf67 OS=Homo sapiens GN=C2orf67 PE=1 SV=2 (Range: 362-412), from NEW_HUMAN_DOMAINS

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50
# Score Template Links and tools%idFirst AVNCSTEWKWLVDRARVGSRWTWLQAQISDLECKIQQLTDIHRQIRASKGILast
1 -5.7602ovc_A mol:protein length:33 Potassium voltage-gated channel subfamily KQT member 4  ali model follow..  21  2..........AVDEISMMGRVVKVEKQVQSIEHKLDLLLGFY......... 33
2 -5.7303brv_A mol:protein length:48 Inhibitor of nuclear factor kappa-B kinase subunit beta  ali model follow..  31  33...........QDQSFTALDWSWLQTE........................ 48
3 -5.4602q6q_A mol:protein length:74 Spindle pole body component SPC42  ali model follow..  39  50.......................LQIKISDLEKKLSDANSTFKEMR..... 72
4 -5.3603bj4_A mol:protein length:49 Potassium voltage-gated channel subfamily KQT member 1  ali model follow..  20  14...............TIGARLNRVEDKVTQLDQRLALITDMLHQLLSLHG. 48
5 -5.2601hbw_A mol:protein length:57 REGULATORY PROTEIN GAL4  ali model follow..  14  2........................RAHLTEVESRLERLEQLFLLIFPREDL 28
6 -5.0501r8h_A mol:protein length:87 Regulatory protein E2  ali model follow..  12  19.FRYRLNDKHRHLFDLISSTWHWASPKAPHKHAIVEQRQQFLNVVKIPPTI 75
7 -5.0103e7k_A mol:protein length:56 TRPM7 channel  ali model follow..  21  20...............EVGDRVNYIKRSLQSLDSQIGHLQDLSALTVDT... 52
8 -4.7502fxm_A mol:protein length:129 Myosin heavy chain, cardiac muscle beta isoform  ali model follow..  15  81.......................LEAKVKEMNERLEDEEEMNAELTAKK.. 106
9 -4.7305vms_A mol:protein length:548 Potassium voltage-gated channel subfamily KQT member 1  ali model follow..  15  507...........KGINTIGSRLNRVEDKVTQMDHKLNLITDMLHHLLTNQ.. 544
10 -4.6402o26_A mol:protein length:145 Kit ligand  ali model follow..  19  33.............GMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGL.. 68

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 4 6 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Godzik A. Fold recognition methods. Methods Biochem Anal. 2003;44:525-46. Review.