current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|Q96T21|SEBP2_HUMAN Selenocysteine insertion sequence-binding protein 2 OS=Homo sapiens GN=SECISBP2 PE=1 SV=2, from NEW_HUMAN_DOMAINS

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst MASEGPREPESEGIKLSADVKPFVPRFAGLNVAWLESSEACVFPSSAATYYPFVQEPPVTEQKIYTEDMAFGASTFPPQYLSSEITLHPYAYSPYTLDSTQNVYSVPGSQYLYNQPSCYRGFQTVKHRNENTCPLPQEMKALFKKKTYDLast
1 -25.7001i3q_A mol:protein length:1733 DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT  ali model follow..  17 1573.TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSPTSPSYSPTSYSPTSPSYSPTSPSYSPTSPSYSPTSPPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR. 1733
2 -23.1003h0g_A mol:protein length:1752 DNA-directed RNA polymerase II subunit rpb1  ali model follow..  15 1595.TSPSYSPTSPSYSATSPSYSPTSPSYSPTSPSYSPTSPSPTSPSYSPTSYSPTSPSYSPTSPSYSPTSPSYSPTSPPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPS.... 1752
3 -22.8005x4z_A mol:protein length:1743 DNA-directed RNA polymerase subunit  ali model follow..  15 1577.TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSPTSPQYSPTSYSPTSPQYSPTSPQYSPTSPQYSPTSPPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPASPQYSPSRHSPNGESKEGE.. 1743
4 -19.5006gml_A mol:protein length:1973 DNA-directed RNA polymerase subunit  ali model follow..  12 1824.SSPSYSPSSPSYSPTSPKYTPTSPSYSPSSPEYTPTSPSPTSPKYSPT-----SPKYSPTSPTYSPTTPKYSPTSPPTSPVYTPTSPKYSPTSPTYSPTSPKYSPTSPTYSPTSPTYSPTSPGYSPTSPTYSLTSPAISPDDSDEEN. 1973
5 -8.3505n5y_P mol:protein length:894 RNA polymerase I-specific transcription initiation factor RRN6  ali model follow..  10  750.PSLFEPIQNEISRSLSGPYQDIISSWDMDDINEEDESNEFNFDS--------QFSAPFNGRPPFNLNSQSQIPTIKSSQSSGLARRKRILKTQSQKATPLSQSTQNLSVLPDSMTPAFTLMQPPSSQISFVNDSQPRNSQKAKKKKK. 888
6 -8.0303gdb_A mol:protein length:937 Putative uncharacterized protein spr0440  ali model follow..  1MAGHHHQ----ENLYFQGE-ETAVPENSGANTELVSGESE-----------HSTNEADKQNEGEHARENKLEKAEGVATASETASPASNEAATTETAEAASAAKPEEKASEVVAETPSAEAKPKSDKETEAKPEATNQGDESKPAAE.. 132
7 -7.3203jcm_A mol:protein length:2413 Pre-mRNA-splicing factor 8  ali model follow..  1MSGLPPPPPGFEEDSDLALPPPPPPPPGYEIEELDNPMVPSSVNEDTFLPPPPPPPSNFEINAEEIVDFTLPPPPPPPGLDELETKAEKKVELHGKRKLDIGKDTFVTRKSRKRAKKMTKKAKRSNLYTPKAEMPPEHLRKIINTH... 146
8 -6.9302huj_A mol:protein length:140 Lin2004 protein  ali model follow..  17  1MGSDKIENLYFQGMELLIRTEQLLLQNEKNWELYLSNREEEKPFDFYKDMKPFVDE............................................................................................. 56
9 -6.3704hsi_A mol:protein length:703 Envelope glycoprotein B  ali model follow..  11  1....................DPAAPTSPGTPGVAAATQAANGGPA------PAPPPLGAAPTGDPKPKKNKKPKNPTPPRPAGDNATVAAGHATLREHLRDIKAENTDANFYVCPPP--TGATVVQFEQPRRCPTRPEGQNYTE..... 117
10 -6.0205ife_C mol:protein length:1304 Splicing factor 3B subunit 1  ali model follow..  10  226.HTPSLRWDETPGRAKGSETPGATPGSKIWDPTPSHTPAGAATPGRGDT--PGHGGATSSARKNRWDETPKTERDTPGHGSGWAETPRTDRGGDSIGETPTPGASKRKSRWDETPAS-PGKTPIGTPAMNMATPTPGHIMSMTPEQL.. 383

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 6 4 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ginalski K, Grishin NV, Godzik A., Rychlewski L. Practical lessons from protein structure prediction. Nucleic Acids Res. 2005 Apr 1;33(6):1874-91.