current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|A0AUZ9|CB067_HUMAN Uncharacterized protein C2orf67 OS=Homo sapiens GN=C2orf67 PE=1 SV=2 (Range: 362-412), from NEW_HUMAN_DOMAINS

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50
# Score Template Links and tools%idFirst AVNCSTEWKWLVDRARVGSRWTWLQAQISDLECKIQQLTDIHRQIRASKGILast
1 -5.810d1uuja_ a.221.1.1 (A:) Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  29  50................LEKKWT-LQKKVMELESKLNEAKE........... 76
2 -5.440d1jiha1 d.240.1.1 (A:390-509) DNA polymerase eta {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  23  25.....................SWLEVFCAELTSRIQDLEQEYNKIVIPRTV 54
3 -5.050d1r8ha_ d.58.8.1 (A:) Papillomavirus-1 E2 protein {Human papillomavirus type 6a [TaxId: 37122]}  ali model 3D-neighbors follow..  12  19.FRYRLNDKHRHLFDLISSTWHWASPKAPHKHAIVEQRQQFLNVVKIPPTI 75
4 -4.830d1scfa_ a.26.1.2 (A:) Stem cell factor, SCF {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  25.............GMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGL.. 60
5 -4.830d4ohja2 d.15.6.1 (A:134-234) automated matches {Staphylococcus aureus [TaxId: 1280]}  ali model 3D-neighbors follow..  26  30........................QLAISTLDFEIRHQHGLYRSSDKTGG. 59
6 -4.650d1r6ta1 a.16.1.3 (A:7-60) N-terminal domain of eukaryotic tryptophanyl-tRNA synthetase (TrpRS) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  1.........................ASLLELFNSIATQGELVRSLKAGNA. 25
7 -4.150d1wh2a1 d.76.1.1 (A:8-72) Hypothetical rotein At5g08430 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}  ali model 3D-neighbors follow..  10  9...EKLNWLYKDPQGLVQGPFSWSDAEYFTKQFRVWMTGE........... 51
8 -3.820d5n4fa2 b.69.7.1 (A:7-455) Prolyl oligopeptidase, N-terminal domain {Galerina marginata [TaxId: 109633]}  ali model 3D-neighbors follow..  11  25..............VPVPDPYQWLEESTDEVDKWTTAQADLAQSYLDQ... 58
9 -3.790d2bopa_ d.58.8.1 (A:) Papillomavirus-1 E2 protein {Bovine papillomavirus type 1 [TaxId: 10559]}  ali model 3D-neighbors follow..  10  16.YRFRVKKNHRHRYENCTTTWFTVADNGAERQGQAQQRQDFLKHVPLPPGM 74
10 -3.690d5yfka_ b.100.1.0 (A:) automated matches {Clostridium perfringens [TaxId: 195102]}  ali model 3D-neighbors follow..  11  49......................WIKVEGTNIDFPVVQGKDNDFYLHHN... 74

FFAS is supported by the NIH grant R01-GM087218-01
1 3 1 7 3 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Grynberg M, Topczewski J, Godzik A., Paszewski A. The Aspergillus nidulans cysA gene encodes a novel type of serine O-acetyltransferase which is homologous to homoserine O-acetyltransferases. Microbiology. 2000 Oct;146 ( Pt 10):2695-703.