current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|A0JNW5|UH1BL_HUMAN UHRF1-binding protein 1-like OS=Homo sapiens GN=UHRF1BP1L PE=1 SV=2, from NEW_HUMAN_DOMAINS

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .
# E-value Template Links and tools%idFirst KKSLYLPQEMSAVYIEFTEYYYPDGKDFPIPSPNLYSQLNALQFTVDERSILWLNQFLLDLKQSLNQFMAVYKLNDNSKSDEHVDVRVDGLMLKFVIPSEVKSECHQDQPRAISIQSSEMIATNTRHCPNCRHSDLEALFQDFKDCDFFSKTYTSFPKSCDNFNLLHPIFQRHAHLast
1 1.000e-64UniRef50_A0A2I0LUJ3 UHRF1 binding protein 1-like n=13 Tax=Vertebrata TaxID=1261581 RepID=A0A2I0LUJ3_COLLI  ali  84  517KKSLYLPPEMPAIHVEFTEYYYPDGKDFPIPCPNLYGQLNALQFTLDERSILWLNQFVLDLKQSLIQFMAMYKLNDNSKSDEHVDVRVDGLMLKFIIPSENKPEIHKDQPRALSIQSSEMIATNTRYSPNCRHSDLEALFQNFKDSEFFSRTFTTFPKSPKNFNLLHPIFQRHAH 691
2 1.000e-63UniRef50_A0A091Q5Q3 UHRF1-binding protein 1-like (Fragment) n=22 Tax=Tetrapoda TaxID=32523 RepID=A0A091Q5Q3_LEPDC  ali  85  474KKSLYLPPEMPAIHFEFTEYYYPDGKDFPIPSPNLYGQLNALQFTLDERSILWLNQFVLDLKQSLIQFMAMYKLNDNSKSDEHVDVRVDGLMLKFIIPAENKPEIHKDQPRALSIQSSEMIATNTRYSPNCRHSDLEALFQNFKDCEFFSRTFTTFPKSQKNFNLLHPIFQRHAH 648
3 2.000e-63UniRef50_G1NGG1 UHRF1 binding protein 1 like n=14 Tax=Amniota TaxID=32524 RepID=G1NGG1_MELGA  ali  85  131KKSLYLPPEMPAIHIEFTEYYYPDGKDFPIPCPNLYGQLNALQFTLDERSILWLNQFVLDLKQSLIQFMAMYKLNDNSKSDEHVDVRVDGLMLKFIIPAENKLEIHKDQPRALSIQSSEMIATNTRYSPNCRHSDLEALFQNFKDCEFFSRTFTTFPKSQKNFNLLHPIFQRHAH 305
4 5.000e-62UniRef50_A0JNW5 UHRF1-binding protein 1-like n=437 Tax=Gnathostomata TaxID=35060 RepID=UH1BL_HUMAN  ali  100  488KKSLYLPQEMSAVYIEFTEYYYPDGKDFPIPSPNLYSQLNALQFTVDERSILWLNQFLLDLKQSLNQFMAVYKLNDNSKSDEHVDVRVDGLMLKFVIPSEVKSECHQDQPRAISIQSSEMIATNTRHCPNCRHSDLEALFQDFKDCDFFSKTYTSFPKSCDNFNLLHPIFQRHAH 662
5 1.000e-61UniRef50_UPI000938EFF8 UHRF1-binding protein 1 isoform X3 n=1 Tax=Meleagris gallopavo TaxID=9103 RepID=UPI000938EFF8  ali  57  400RKFLNLPDQVSAIHIEFTEYYFPDNQDFPVPCPNLYVQLNGLTLTLDTASMLWINLFCLDLYRSLEQFKAIYKLEDSGKRDEHVDVRLDGFQLKLSIPVEKKVAAHQDRPQALCIHTSELTATNTRHAPSCSCQDLQSLFRKFAGSEFFHSSYTHFPRSQDNFNLLHTLFLRHAY 574
6 5.000e-61UniRef50_A0A1S2ZNJ9 UHRF1-binding protein 1-like isoform X1 n=7 Tax=Amniota TaxID=32524 RepID=A0A1S2ZNJ9_ERIEU  ali  93  206KKSLYLPQEMSAIYIEFTEYYYPDGKDFPIPSPNLYSQLNALQFTVDERSILWLNQFLLDLKQSLNQFMAVYKLNDSSKSDEHVDIRVDGLMLKFVIPSEMKSECHKDQPHAVSIQSSEMIATNTRHCPNCRHSDLEALFQDFKDCDFFSKTYTRFPKSCNSFDLLHPIFQRHAH 380
7 1.000e-60UniRef50_K7FB97 UHRF1 binding protein 1 n=121 Tax=Sarcopterygii TaxID=8287 RepID=K7FB97_PELSI  ali  56  492RKSLNLPDQVSAIHIEFTEYYFPDNQDFPVPYPNLYMQLNDLMLTLDVTSMLWVNLFCLDLYRSLEQFKAIYKLEDSEKQDEHVDIRLDGFRLKLSIPVEKKVTDHRDRPKALCIHTSEVTATNSRYDPHCSCSALQNLFRRFANSEFFHSTYTQFPKSQDNFSVLHTLFLRHAY 666
8 1.000e-60UniRef50_A0A0S7IT44 UH1BL (Fragment) n=2 Tax=Clupeocephala TaxID=186625 RepID=A0A0S7IT44_9TELE  ali  62  126KKSLYLPPEMPAIHVEFTEYYFPDGKDYPIPCPNLYAQLNALQLVLDPRSLVWINLFALDLRQSLEQFMQIYKLNDSQKPDEHVDIKVDGLMLKLVVPTEPDASYAADLPRSVSIQTSEMVATNTRHPPNCTRSHLEALLQAFEGEPFFSPSFSTFPRSPSSVPVLHPVFQQHAH 300
9 5.000e-60UniRef50_D2I4W3 Uncharacterized protein (Fragment) n=7 Tax=Amniota TaxID=32524 RepID=D2I4W3_AILME  ali  96  22KKSLYLPQEMSAVYIEFTEYYYPDGKDFPIPSANLYSQLNALQFTVDERSILWLNQFLLDLKQSLNQFMAVYKLNDNSKSDEHVDIRVDGLMLKFVIPSEMKSECHQDQPHAVSIQSSEMIATNTRHCPNCRHSDLEALFQDFKDCDFFSKAYTSFPKSGDNFNLLHPIFQRHAH 196
10 8.000e-60UniRef50_F1R2T5 UHRF1-binding protein 1-like n=4 Tax=Osteoglossocephalai TaxID=1489341 RepID=F1R2T5_DANRE  ali  60  501KKSLYLPQEMPAIHAEFTEYYFPDGKDYPVPCPNLYVQLNALQLVLDSRSLVWLNLFALDLRQSLEQFMDLYKLNDSQKPEEHVDIKVDGLMLKLVIPADHEKT-QPDQPRSVSVQTSEMVATNTRHSSACSRSSLEALLQAFQEQPFFTSLSSTFPRAPSSFSVLHSVFQRHAH 674
11 1.000e-59UniRef50_Q5RGW0 UHRF1-binding protein 1-like n=151 Tax=Neopterygii TaxID=41665 RepID=Q5RGW0_DANRE  ali  60  473KKSLYLPQEMPAIHAEFTEYYFPDGKDYPVPCPNLYVQLNALQLVLDSRSLVWLNLFALDLRQSLEQFMDLYKLNDSQKPEEHVDIKVDGLMLKLVIPADHEKT-QPDQPRSVSVQTSEMVATNTRHSSACSRSSLEALLQAFQEQPFFTSLSSTFPRAPSSFSVLHSVFQRHAH 646
12 4.000e-59UniRef50_A0A2I0LJW3 UHRF1 binding protein 1 (Fragment) n=6 Tax=Sauria TaxID=32561 RepID=A0A2I0LJW3_COLLI  ali  54  523RKFLKCPDQVSAIHIEFTEYYFPDNQDFPVPCPNLYAQLNGLMLTLDTASVLWINLFCLDLYRSLEQFKAIYKLEDSGKRDEHVDVRLDGFRLKLNIPVEKKVADHPDRPQSLCVCASEVTATNTRHAPFCACQDLQGLFRRFASSEFFHSSYTKFPRAQDNFSLLHTLFLRHAY 697
13 7.000e-59UniRef50_A0A0P7WZZ0 UHRF1-binding protein 1-like (Fragment) n=1 Tax=Scleropages formosus TaxID=113540 RepID=A0A0P7WZZ0_9TELE  ali  65  200KKSLYLPQEMPAIHVEFTEYYFPDGKDYPIPCPNLYAQLNALQLVLDPRSLVWLNQFALDLRQSLEQFMELYKLDDSQKPDEHVDIKVDGLMLKLVLPTEQELSGSSDMPGCVSIQTSEMVATNTRHAPGCRRSDLEEVLQDFQVEDFFVHGPTSFPRSTDAFRILHPVFQRHAH 374
14 1.000e-58UniRef50_B3DL79 LOC100170465 protein n=15 Tax=Sarcopterygii TaxID=8287 RepID=B3DL79_XENTR  ali  77  486KKSLYLPQEMSAIHIEFTEYYFPDGKNFPIPNPNLYVQLNALQFTLDERSILWLSQFVLDLRQSLNQFMAMYMLNDNSKSDEHVDIRIDGLMLKLIIPSQKKQDCHPDQPVAISIQTSEMIASNTRQSANCRRSDLEAIFQDFKDYDFYSETFTSFPRSHESFHILHPIFQRHA. 659
15 1.000e-58UniRef50_UPI0008474AF8 UHRF1-binding protein 1-like isoform X3 n=1 Tax=Xenopus tropicalis TaxID=8364 RepID=UPI0008474AF8  ali  77  458KKSLYLPQEMSAIHIEFTEYYFPDGKNFPIPNPNLYVQLNALQFTLDERSILWLSQFVLDLRQSLNQFMAMYMLNDNSKSDEHVDIRIDGLMLKLIIPSQKKQDCHPDQPVAISIQTSEMIASNTRQSANCRRSDLEAIFQDFKDYDFYSETFTSFPRSHESFHILHPIFQRHA. 631
16 1.000e-58UniRef50_UPI000457540B UHRF1-binding protein 1 n=1 Tax=Callorhinchus milii TaxID=7868 RepID=UPI000457540B  ali  54  494RQNYHLPTGISAIHIEFTEYYFPDSKAFPVPCPNLYVQLNTLQFTLDPTSMLWMNTFSLDLYQTLQQFKAIYKLDDSGKADEHVNFCMNGLMLKFVIPVEKKEMDHPDRPQYLTIQTSDMVATNTRHSVNCMYQDLQSVLMDFQNSEFFDSTYKEFPKSANSFNVLHNMFLQHV. 667
17 6.000e-58UniRef50_Q6BDS2 UHRF1-binding protein 1 n=260 Tax=Sarcopterygii TaxID=8287 RepID=URFB1_HUMAN  ali  50  496RKLHNLPTQVSAIHIEFTEYYFPDNQELPVPCPNLYIQLNGLTFTMDPVSLLWGNLFCLDLYRSLEQFKAIYKLEDSSQKDEHLDIRLDAFWLKVSFPLEKRERAELHRPQALVFSASGMIATNTRHAPHCSCSDLQSLFRGFAAAEFFHSNYDHFPKVPGGFSLLHMLFLHHA. 669
18 6.000e-58UniRef50_F1RZ15 UHRF1 binding protein 1 n=2 Tax=Cetartiodactyla TaxID=91561 RepID=F1RZ15_PIG  ali  50  498RKLHNLPTQVSAVHIEFTEYYFPDNQELPVPCPNLYIQLNGLTFTVDPVSLLWGNLFCLDLYHSLEQFKAIYKLEDPSQKDEHVDIRLDAFWLKVSFPLEKREQAGLHRPQALVFSASGMTATNTRHAPHCSCPDLQSLFRGFAAAEFFHSNYVQFPKVPGGFSLLHMLFLHHA. 671
19 6.000e-58UniRef50_A0A088AFV7 Uncharacterized protein n=121 Tax=Hymenoptera TaxID=7399 RepID=A0A088AFV7_APIME  ali  31  508RDKFCLPEDVTIVHAEFTYYYYPGDITFPLPPPKFYVQLNPIQVNFDVSSCLWFNSFALNLYYSL--MNKDKQTTYTSTTLMYFDVKIEAILPRIVFESPQDYPNQKDRPKSLHIQTSRASITNVRCTERSSRADLAQCVNAFQMGQMFFS--TEFPNRSNDFHVLTDKFLAH.. 676
20 2.000e-57UniRef50_V8PA56 UHRF1-binding protein 1 (Fragment) n=3 Tax=Sauria TaxID=32561 RepID=V8PA56_OPHHA  ali  53  139RKLLKLPEHTSAIHIVFTEYYFPDQTTFPVPSPNLYLQMNGLVFTLDTRSMLWVNLFCLDLYRSLQQFKAIYKLESSGKREEHIDIRLDGFILKVNIPVDKKVIDHQDRPQCLSMSTSEVTATNTRHAPHCSCLALQNLFRRFAASEFFHSSYTKFPKFQDNFSLLHTLFLRHAY 313
21 4.000e-57UniRef50_H0VTC0 UHRF1 binding protein 1 n=4 Tax=Hystricomorpha TaxID=33550 RepID=H0VTC0_CAVPO  ali  50  342RKLHNLPAQISAIHIEFTEYYFPDSQELPVPCPNLYIQLNDLTFTVDPVSLLWGNLFCLDLYHSLEQFKAIYKLEDSRRKDEHLDIRLDAYRLKVSFPLEKRELAKLYRPQALVISASGMVATNTRHAPHCGCSDLQNLFRGFAATEFFHSNYGHFPKVPGGFSLLHILFLHHA. 515
22 5.000e-57UniRef50_E9JAI6 Uncharacterized protein (Fragment) n=1 Tax=Solenopsis invicta TaxID=13686 RepID=E9JAI6_SOLIN  ali  29  6RDRFSLPEDVTILHAEFTYYYYPGDITFPLPPPKFYVQLNPIQINFDVCSCLWFNSFALNLYHSLME----KDKQLSSSRLMYFDVKIEAILPRIVFESQQDYPNQKDRPKSLHLQTSRASITNVRSTERSSRADLAQCLNAFQMGQMFFG--AEFPSKSGDFHVVTDKFLVH.. 172
23 5.000e-57UniRef50_B2KF50 UHRF1 (ICBP90)-binding protein 1 n=12 Tax=Theria TaxID=722675 RepID=B2KF50_MOUSE  ali  48  494RKRHHLPPQVAAIHVQFTEYYFPDNQELPVPCPNLYIQLNGLTFTVDPVSLLWGNLFCLDLYRSLEQFKAIYKLEASRGRDEHVDVRLDAFWLKVSFPLETRELAKLHRPQALVLSTSSMIATNTRHAPNCTRPDLQSLFRGFAATEFFRCSYGHFPQVAGGFSLLHMLFLHHA. 667
24 8.000e-57UniRef50_UPI0007DA66C6 UHRF1-binding protein 1 isoform X4 n=1 Tax=Cricetulus griseus TaxID=10029 RepID=UPI0007DA66C6  ali  47  135RKRHHLPTQVAAIHVQFTEYYFPDNQELPVPCPNLYIQLNGLTFTVDPVSLLWGNLFCLDLYRSLEQFKAIYKLEDSRQKDEHLDIRLDAFLLKVSFPLEKREQAKLHRPQALVLSTSGLIATNTRHAPHCSCPDLQSLFRGFAAAEFFRSSYGHFPKAPGGFSLLHTLFVHHA. 308
25 9.000e-57UniRef50_U6DFY0 UHRF1-binding protein 1 (Fragment) n=2 Tax=Laurasiatheria TaxID=314145 RepID=U6DFY0_NEOVI  ali  50  194RKLHNLPTQVSAIHIEFTEYYFPDNQELPIPCPNLYIQLNGLTFTMDPVSLLWGNLFCLDLYRSLEQFKAIYKLEDSSQKDEHLDIRLDAFWLKVSFPLEKKEQAGLHRPQALVFSASGMTATNTRHAPHCSCPDLQSLFRGFAATEFFHSNYVHFPKVPGGFSLLHMLFLHHA. 367
26 1.000e-56UniRef50_A0A067QLG8 UHRF1-binding protein 1-like n=6 Tax=Termitoidae TaxID=1912919 RepID=A0A067QLG8_ZOONE  ali  28  34RDRYSLPEDLPILHAEFTYYYYPGDIPFPLPQPKFYVQVNPIQIHFDVCSCLWLNSFALNLHQSLLSSN--PEQQQAAAALMYMDVKLEAIMPRVIFESSAEHPNQRDRPKSLHFQVSRVSVTNVRSMEHSSRADLAKCIDTYQLGSLFFG--ADFPALPDDYHVVTDKFLKHV. 203
27 2.000e-56UniRef50_H3BBE8 UHRF1 binding protein 1 like n=2 Tax=Latimeria chalumnae TaxID=7897 RepID=H3BBE8_LATCH  ali  69  305KRSLYLPKEMQAVHIEFTEYYFPDGKDFPVPCPNLYIQLNALQFTLDARSVLWLNQFVLDLTQSLNQFMAKYKLDDRSKPDEHVDIQVNGLMLKLIIPLDKELDDHQDLPRTISVQTSEMIATNTRNSQKCTRSNLEAMLQDFKENEFFSKSFTHFPRSTGSFNLLHQVFQRHAH 504
28 2.000e-56UniRef50_UPI0009A408EA LOW QUALITY PROTEIN: UHRF1-binding protein 1 n=1 Tax=Rhincodon typus TaxID=259920 RepID=UPI0009A408EA  ali  55  517RTSYHLPAGMSAIHIEFTEYYFPDSKEFPVPSPNLYVKLNALQFTLDPVSMLWMNSFSLDLYQTLQQFKAIYKLNNSVKVDEHVDFCMNGLMLKFIIPVDKKVMAHPDRPQYLTIQTSDVVATNTRHSLNCTHSDLQMVLKAFKDFEFFHVSYKEFPKYADSFDVLQNVFFLHA. 690
29 3.000e-56UniRef50_G1SGM5 UHRF1 binding protein 1 n=29 Tax=Amniota TaxID=32524 RepID=G1SGM5_RABIT  ali  48  406RKLHNLPTQVSAIHIEFTEYYFPDNQELPVPCPNLYIQLNGLTFTMDPVSLLWGNLFCLDLYRSLEQFKAIYKLEDSSQKDEHLDIRLDAFWLKVSFPLQKRERAESHRPQALVFSASGMIATNTRHAPHCSCPDLQSLFRGFAATEFFHSSYDRFPKVPGGFSLLHMLFVYHA. 579
30 3.000e-56UniRef50_A0A0C9RKV9 Uhrf1bp1l protein n=8 Tax=Holometabola TaxID=33392 RepID=A0A0C9RKV9_9HYME  ali  28  495RDKFCLPDDVTIIHAEFTYYYYPGDISFPLPPPKFYVQANPLQINYDVFSCLWFNSFVLNLYQSLLSAENHTEDT----DVMYFDVKLEAILPRIVLETQHDYPNQRDRPKSLHLQISRVSVTNVRSTERSSRADLAECLNAFQMGQMFYSS--EFPSKDTDFRVIPEKFLSH.. 661
31 8.000e-56UniRef50_D3ZMR2 UHRF1-binding protein 1 n=2 Tax=Rattus norvegicus TaxID=10116 RepID=D3ZMR2_RAT  ali  46  494RKRHRLPSQVAAIHVQFTEYYFPDNQELPVPCPNLYIQLNGLTLTVDPVSLLWGNLFCLDLYRSLEQFKAIYKLEDPRGKDEHLDIRLDAFWLKVSFPLETRDLAKLHRPQALVLSTSGVIATNTRHAPHCSCPDLQGLFRGFAATEFFRSSYGHFPKVPGGFSLLHMVFLHHA. 667
32 1.000e-55UniRef50_H9F529 UHRF1-binding protein 1 (Fragment) n=1 Tax=Macaca mulatta TaxID=9544 RepID=H9F529_MACMU  ali  48  82RKLHNLPTQVSAIHIEFTEYYFPDNQKLQVRCPNLYIQLNGLTFTMDPVSLLWGNLFCLDLYRSLEQFKAIYKLEDSSQKDEHLDIRLDAFWLKVSFPLEKRERAELHRPQALVFSASGMIATNTRHAPHCSCSDLQSLFRGFAAAEFFHSNYDHFPKVPGGFSLLHMLFLHHA. 255
33 4.000e-55UniRef50_UPI0009A2CCB2 UHRF1-binding protein 1-like isoform X1 n=2 Tax=Rhincodon typus TaxID=259920 RepID=UPI0009A2CCB2  ali  67  495KKSLYLPSEMAAIHIEFTEYYFPDGKDFPVPCPNLYVQVNALQFTLDARSMLWLNQFMLDLRQSLEQFTAIYKLDIA-KEDEHVDIRIDGLMLKFIIPTDKRPDDHQDRPQSISIQTAEVLATNTRHSSNCTRSDLEAIIQEFKDDKFFSKMFTTFPKTAESFNVLHPVFQRHAH 696
34 9.000e-55UniRef50_UPI0007B8FABD UHRF1-binding protein 1-like isoform X1 n=13 Tax=Clupeocephala TaxID=186625 RepID=UPI0007B8FABD  ali  41  494RKSLHLPDNTPAIHLQFTEYYFPDNPGLPVPCSNLYAQLNGLQLCLDAPSVLWMTLFSRGLHKTLDQVKAFYHLQDSSKTDEHIDIRLDATQLKLIIPLESSILDHPDRPQSLSISLPQIILSNTRHAPHGSHSDLNSTYSSFSTCTFFHPMVCQFPRDQSILLPLPSAFLQH.. 667
35 6.000e-54UniRef50_UPI0007AC8D14 UHRF1-binding protein 1-like n=1 Tax=Sinocyclocheilus grahami TaxID=75366 RepID=UPI0007AC8D14  ali  39  438RKSLHLPDNTPAIHLQFTEYYFPDNPGLPVPCSNLYAQLNGLQLYLDAPSVLWMTLFSRGLHKTLDQVKAFYHLQDSSKMDEHIDIRLDATQLKLIIPLESSILDHPDRPQSLSVSLPQIVLSNTRHAPHGSHSDLNSTYSSFSARPFFHPMVCQFPRDQSVLHPLPSAFLQH.. 611
36 3.000e-53UniRef50_UPI0004980A71 UHRF1-binding protein 1-like isoform X1 n=3 Tax=Euteleosteomorpha TaxID=1489388 RepID=UPI0004980A71  ali  64  479KKSLYLPPEMPAIHVEFTEYYFPDGKDYPIPCPNLYAQLNALQLVLDPRSLVWLNLFALDLRQSLEQFMEIYKLNDSQKPDEHVDVKVDGLMLKLVIPTDRDASCPPDLPRSISVQTSEMVATNTRHPANCTRSHLEALLQAFEEEPFFSSSFSSFPRSSSSLPILHPVFQRHAH 653
37 5.000e-53UniRef50_J9K334 Uncharacterized protein n=12 Tax=Aphididae TaxID=27482 RepID=J9K334_ACYPI  ali  26  454KERHKLPHDSKVIHAEFTHYYYPGDVAFPLPPSKFYAQLNPVQMNFDTLTVLWLNTFALNVYKSLMTTNVANQDNL--GNMIYFDILVEAIMPRFIFEEEKLCNNQKDRPKSLNLQTSRATLSNVRSNEHGSRSDLANCVNGLQFASLFYSS--EYPAKDGDYHPVTEKLLNHAQ 625
38 9.000e-53UniRef50_W4XNM2 Uncharacterized protein n=1 Tax=Strongylocentrotus purpuratus TaxID=7668 RepID=W4XNM2_STRPU  ali  32  52KNTFHLPPEIPSIHVEYMSFYFPNELDFPVPAPVIYAQINPMQLRLDNTTLLWLNQFAFNVMQTLPEIDEIAPASQTSTGQDHIDIRVDALMQKVLIPVPDPVANQPDRPKILQVQVSQVTATNCRVGTNSSRPDLSKVLQKFQGVQLFHT--TTFPSNKTDLQTLPAKFWKHAY 224
39 1.000e-52UniRef50_A0A1W4WPF2 UHRF1-binding protein 1-like n=2 Tax=Neoptera TaxID=33340 RepID=A0A1W4WPF2_AGRPL  ali  28  479KDRISLPENSNILHAEFIYFYYPSDTAFPLPPPKFYVHANPIQIYFDVDTCLWLNSFGLTLYQSLLS----SKQQASSSDITYVDVKIEAILPKIIFESAAEYPNQRDRPKSLHFNVTRATITNVRNLQQSSRADLAKCVESFHSGSLFFGS--DFPSKSGDFYLVTQKFLDH.. 645
40 2.000e-52UniRef50_U4U3Y4 Uncharacterized protein n=1 Tax=Dendroctonus ponderosae TaxID=77166 RepID=U4U3Y4_DENPD  ali  29  223RNRMSLPKEASIIHAEYIYYYYPSEVPFPLPAPKFYVQVNPIQIVFDRDTCLWLNCFLLNLYRSLLTT----EAKDSASSFTYIDIKVEAILPRLNFESTAEYHNQRDRPKCLSMQVTRATITNVRSLEHSSRADLAKCIDSFSMASLFFG--TDFPSKVGDFYVVTEKFLDH.. 389
41 5.000e-52UniRef50_D1ZZL6 UHRF1-binding protein 1-like n=22 Tax=Holometabola TaxID=33392 RepID=D1ZZL6_TRICA  ali  30  494RDHMTLPKDASIVHAEFIYYYYPSDIPFPLPPPKFYVHLNPVQIVFDVDSCLWLNSFGLNLYQSLMSSKQPTGAS----NYTYVDVKIEAILPRLNFESTIDYPNQRDRPKTLSFQVTRVNITNVRSLEQSSRADLAKCVDSFHMGSLFFG--TDFPSQPADFYVVTQKFLDH.. 660
42 6.000e-52UniRef50_A0A2I4AW11 UHRF1-binding protein 1-like isoform X1 n=24 Tax=Percomorphaceae TaxID=1489872 RepID=A0A2I4AW11_9TELE  ali  62  527KKSLYLPPEMPAVHVEFTEYYFPDGKDDPIPCPNLYAQLNALQLVLDPRSLVWINLFALDLRQSLEQFMEIYKLNDSQKPDEHIDIKVDGLMLKVVVPTDQDASCPADLPRSVSIQTSEMVATNTRHPANCTRSHLEALLQAFEEEPFFSSSFSSFPRSSSSVPVLHPVFQRHAH 701
43 7.000e-52UniRef50_A0A2I4D888 UHRF1-binding protein 1 n=9 Tax=Percomorphaceae TaxID=1489872 RepID=A0A2I4D888_9TELE  ali  40  484RKALNLPDNVPAVHLQFTEYYFPDSSSLPAPTSKLYAQLNGLQLCVDPVSMLWINLFSRGLLHTLDQVKAFYHLQDSSKADEHMDVRLDAAQLKLIIPLDSSILDHPERPQSLSVVMPQIVVSNTRHCPHGSKADLSSTCEKFSGRSFFQPPPCPYPRDLSAFHPLPSCFLRHAQ 659
44 1.000e-51UniRef50_UPI000947A5D1 UHRF1-binding protein 1-like n=1 Tax=Branchiostoma belcheri TaxID=7741 RepID=UPI000947A5D1  ali  39  452KKALYLPQEMSAVHLEYTEYYFPEGVEHPVPSPNIYGQINAIQLTLDYMTVLWANQFLLNVAQSMAPMDRQESVEEPAPASLHVDIRLEILMPKISLPAEKPVPDQPDRPQALVVQSSRSVLTNSRVGTNCTRDDLKTVLENFSASVL-CREEERFPNKDGDFLQVCNEFWDEA. 626
45 1.000e-51UniRef50_N6U525 Uncharacterized protein (Fragment) n=10 Tax=Polyphaga TaxID=41084 RepID=N6U525_DENPD  ali  29  485RNRMSLPKEASIIHAEYIYYYYPSEVPFPLPAPKFYVQVNPIQIVFDRDTCLWLNCFLLNLYRSLLTT----EAKDTASSFTYIDIKVEAILPRLNFESTAEYHNQRDRPKCLSMQVTRATITNVRSLEHSSRADLAKCIDSFSMASLFFG--TDFPSEIGDFYVVTEKFLDH.. 651
46 2.000e-51UniRef50_UPI000B910441 UHRF1-binding protein 1-like isoform X1 n=2 Tax=Acanthaster planci TaxID=133434 RepID=UPI000B910441  ali  38  552KKTFFLPSEMPSLHIEYTSFYFPDELSFPVPSPVVYVQLNPVQFRLDYTSILWLNQFSFNILQTLPDVDE-YGQGVVSEGRDHTDVRIDALMPKVILPAEEPVLDQPDRPPELHIQMSQVTATNCRVGTGSTRPDLSHILQALNTRKLFVGS-ESFPSAAGDFKTLPRLFWDHAY 731
47 3.000e-51UniRef50_UPI0003F0BFE3 UHRF1-binding protein 1-like n=1 Tax=Saccoglossus kowalevskii TaxID=10224 RepID=UPI0003F0BFE3  ali  29  35.EAFSLPPEMSSLHVEYTSYYFLDGLEYPVPQPNIYVKLNPIKLEMDYMTVLWINLFANHMASGV-QMKPDGGESDILSELYHNDIRIDALMPRITIPAEKMVPDQPDRPNALQIQFSQVILSNCRIATEASRSDLASAIQNLYGGTLF-TDQQQYPNEKSDLTAVSQMLWNHAY 206
48 3.000e-51UniRef50_A0A1A8PEI5 UHRF1 binding protein 1 (Fragment) n=1 Tax=Nothobranchius pienaari TaxID=704102 RepID=A0A1A8PEI5_9TELE  ali  37  168RKALRLPDKVPAIHLQFTEYYFPDNSGVPVPTSSLYAQLNGLQLCVDPASMLWINLFSRGLLHTLDQVKAFYHLQDSGKPEEHVDLRLDAAQLKVIIPLDSSILDHPERPQSLSVIVPQMVLSNTRHCPHGSRSDLSSTCENFASSPFFQPPPCPYPRDLNTFHPIPSTFLQHSQ 343
49 5.000e-51UniRef50_A0A1S3MG43 UHRF1-binding protein 1 isoform X1 n=71 Tax=Neopterygii TaxID=41665 RepID=A0A1S3MG43_SALSA  ali  38  492RKALNLADNIPAIHLQFTEYYFPDNPGLPVPNTNLYVQLNGLQLCLDPASLLWVNLFSRGLLHTLEQVKAFYQLQDGSKAEEHVDIRMDAAQIMLIIPLESSIMDHQDRPQSLNITVPQTVLSNTCHSPHGTRADLNTTYSSFSTCHFFQSPPCSFPRDQSAFLPLPSAFLQHS. 666
50 1.000e-50UniRef50_E0VGD1 uncharacterized protein n=2 Tax=Paraneoptera TaxID=33342 RepID=E0VGD1_PEDHC  ali  30  470KDRFGFPESQTVVHAEFTYYYYPGDDPFPLPAPKFYAQFNPIQIYFDVISILWVNAFALNLYQSLLQTN--TSQNTSTNDIMYFDVKIEAILLRIIMESPIDYPGQKDRPKSLHFVVPRATVTNVRSDKQSSRYDLKKCVDLLKMCSLFFAN--DFPSSETDYPLVSQKFLNH.. 638
51 1.000e-50UniRef50_UPI000B99750D UHRF1-binding protein 1-like n=1 Tax=Nilaparvata lugens TaxID=108931 RepID=UPI000B99750D  ali  27  484RERYMLPTDLKTIHAEFTYYYYPGDIPFPLPPPKFYVHINPVQVYFDVLTLLWLNCFVLNLYQSLMATSAAASLETADIPTMYMDVRLEAISPRLIFESLGEHTGQRDRPKSLHLQVGRVSLTNQRTVAGCSRADLAKCIHHLQRASLFYATSD----NPTDFKVVTDKFIDHLN 655
52 1.000e-50UniRef50_K1PRJ4 UHRF1-binding protein 1-like protein n=3 Tax=Crassostrea gigas TaxID=29159 RepID=K1PRJ4_CRAGI  ali  33  500KKHLHLPPDMSVIHAEFTDYFFPEGVDYPVPHANLYVLLNPIRLNLDWLTLLWANFFMLNLSKSIE------SIELEDAPLEHVDMKLEAIMPRIVMPVEDQKCVLPDFPKSVQLQISRMCATNTRVSGASSWESLSEVITNYTASPLFSS--KSFPNDNNSLRAVPDKFNNHA. 665
53 2.000e-50UniRef50_UPI0006D4E670 UHRF1-binding protein 1-like n=1 Tax=Halyomorpha halys TaxID=286706 RepID=UPI0006D4E670  ali  29  476KERYSFPTDVS-LHAEFTYYYYPGDIAFPLPSPKFYVQINPVYINFDLLTVLWLNSFALNLHQSLV------NTKQESAALNYIDVKIEAIMPRLIFESNNENQGQRDRPKSLQFQVSRALLSNVRSVDCCSRSDLAKCLYASELGSLFYGS--EFPVKNGDLVVVSKKFLDHV. 641
54 4.000e-50UniRef50_A0A060WLA3 Uncharacterized protein n=1 Tax=Oncorhynchus mykiss TaxID=8022 RepID=A0A060WLA3_ONCMY  ali  39  444RKALNLADNIPAIHLQFTEYYFPDNPGLPVPNTNLYAQLNGLQLCLDPASLLWVNLFSRGLLRTLEQVKAFYQLQDGSKAEEHVDIRMDAAQIKLIIPLESSIMDHQDRPQSLNITVPQTVLSNTCHSPHGTRADLNATYSSFSTCHFFQSPPCSFPRDQSAFLPLPSAFLQHS. 618
55 6.000e-50UniRef50_A0A1W5ARC3 UHRF1-binding protein 1 n=5 Tax=Osteoglossocephalai TaxID=1489341 RepID=A0A1W5ARC3_9TELE  ali  37  469RKALHAGDGVPAIHGQFTEYYFPDNPGLPVPCSNLYAQLSGLQLYLDPASVLWVSLFCRGLLRTLDQVKAFYHLQDRGKGEEHVDTRLDATQLRLVIPLESSILDHPDRPQSLSITVPQAVLSNTRHCPHSSRANLHATCSTFSACPFLQPPPPAFPRDQSTFHPLPRAFLHHA. 643
56 8.000e-50UniRef50_A0A2D0SDN5 UHRF1-binding protein 1-like isoform X1 n=23 Tax=Clupeocephala TaxID=186625 RepID=A0A2D0SDN5_ICTPU  ali  64  473KKTLYLPQEMPAIHLEFTEYYFPDGKDYPIPCPNLYVQLNALQLVVDAQSLVWLNLFALDLRHSLVQFMELYKLNDSQKPDEHIDIRVDGLMLKLVIPGDQNQL-EPDQPCSISVQTSEMVATNTRHSPGCSRSDLEALLQAFREQAFFTSSTSS------SFPVLHPVFQRHAH 640
57 1.000e-49UniRef50_UPI0003F0F04D UHRF1-binding protein 1-like n=1 Tax=Saccoglossus kowalevskii TaxID=10224 RepID=UPI0003F0F04D  ali  36  615KKALFLPPEISSLHVEYTSYYFPEGLDFPVPQANVFVKLNPLQLTLDIPTILWLSQFASHMATGV------KDDGGPVIEFEHRDIRIDALMPKFVLPAEPEVLHQPDRPKSLQIQSSQITISNCRSATNSTKSDLGSTLQNMYSGKLF-CERKSYPGDKNDLNGVPKMFWNHAY 782
58 1.000e-49UniRef50_B0W4G6 Uncharacterized protein n=3 Tax=Culicoidea TaxID=41827 RepID=B0W4G6_CULQU  ali  23  459RDRYSLPPDMPTLHAEFTYFYYPGDFVFPLPPSKAFVHVNPVQINFDLDSCLWFSSFALNLHESLLRTNNVTSSLEQPPNLMYMDVKVEVIMPRVVFEASTGAPMQRDRPKSMHVQVSRVAMTNIREMG-ASRADLAQAISSLQEGSLVFGSG--FPSKPGDLCIVTDRILSH.. 643
59 2.000e-49UniRef50_T1JHD7 Uncharacterized protein n=1 Tax=Strigamia maritima TaxID=126957 RepID=T1JHD7_STRMM  ali  31  479KARLMLPQDMSTIHLEWTQYYYPGDYNLPVPPPNMHMQVNSLSLTFDALTLLWLNAFSLSLRKVI--------FDPPSTPSPKMDVRVEGLMPRILFDNTEYPNTQTDRPRKLQLQISRLTVSNSRIGESCGRLDLGKCLEGLQAGELFFCSG--FPSTDGDPHPVNDAFVKHS. 643
60 3.000e-49UniRef50_A0A1S3KDR5 UHRF1-binding protein 1-like n=1 Tax=Lingula unguis TaxID=7574 RepID=A0A1S3KDR5_LINUN  ali  38  512KKSLHLPPEMSSIHVEYTSYYFPQGVDYPVPSSNLFVKVTPFQLTVDYRTILWLNAFMLSLAHT-------ADIEIEDGPKEHVDIRIDLLMPKLILPAEKSVEDQPDRPDSLHIHASRMIITNVEDNDKATLSHLDQLVKKQTSAKLFCSTG--FPNMKEDLESLPDIYATHV. 676
61 8.000e-49UniRef50_A0A1B6KN71 Uncharacterized protein (Fragment) n=1 Tax=Graphocephala atropunctata TaxID=36148 RepID=A0A1B6KN71_9HEMI  ali  27  244RHAMTHVPEIMTLHAEFTYYYYPGDVPFPLPPPKFYVLLNPIQIHFDVLTLLWLNSFTQNLQQSLLNAASG----QDTVALSYIDVKIEAIMPRLILESVGEQVGQKDRPRSLHFTVSRASVTNVRSVERCSRADLAKCVNAYQLGSLFFGE--DFPSRPNDLHVLTDKFISHVQ 412
62 1.000e-48UniRef50_E9QIM9 UHRF1-binding protein 1 n=4 Tax=Clupeocephala TaxID=186625 RepID=E9QIM9_DANRE  ali  41  482RKSLHLPENTPAIHLQFTEYYFPDIPGLPVPSSNLYAQLNGLQLCVDAPSVLWMTLFSRGLHRTLDQVKAFYHLQDSSKTDEHIDIRLDATQLKLIVPLESSILDHPDRPQSLSISFPQIILSNTRQSPHGAHSDLNSTYSSFSSRSFFNTTQCKFPRDQSVLHPLPSAFLQHS. 656
63 3.000e-48UniRef50_R7V169 Uncharacterized protein n=1 Tax=Capitella teleta TaxID=283909 RepID=R7V169_CAPTE  ali  32  496KRQLLLPPEMSSIHADYTEYYFPEGIDFPVPASNLYVVLNPIRLMMDFLTVLWLNAFTLNLLKK-------ADLPQQVEPKQHVDIKINALMPRIILPAEEDQSNVPERPEALQIQISRLMATNCRLDQKASVNELSASLDAFNAAKLYAS-RRKFPQKSTDLLNIPDSFCKHAN 662
64 3.000e-48UniRef50_A0A1B6E5E8 Uncharacterized protein n=1 Tax=Clastoptera arizonana TaxID=38151 RepID=A0A1B6E5E8_9HEMI  ali  30  506........ELMTLHAEFTYYYYPGDISFPLPAPKFYVLLNPVTVNFDLCTLIWLNSFALNLHQSL-----IDSSTTDNSSFPYIDVKIEAIMPKLILESNNNQSVQKDRPKSLHFQVSRAFITNVRSLDRCSRADLSKCINEYQLGSLFYGE--EFPSQSDDLNVVTEKFIQHVE 665
65 8.000e-48UniRef50_UPI000936BFFE LOW QUALITY PROTEIN: UHRF1-binding protein 1-like n=1 Tax=Aedes albopictus TaxID=7160 RepID=UPI000936BFFE  ali  23  507RDRYSLPPEMPTLHAEFTYFYYPGDFVFPLPPSKAFVHINPVQINFDLDSCLWFSSFVLNLHESLLRTNNVTSSSEPQPNLMYMDVKVEVIMPRVIFEASPGAPQQRDRPKEMHVQVARCALTNIREMG-ASRADLAQAISSLQEGSLVFGSG--FPSKPGDLCIVTDRILSH.. 688
66 1.000e-47UniRef50_UPI000C75C4D4 UHRF1-binding protein 1-like n=1 Tax=Eurytemora affinis TaxID=88015 RepID=UPI000C75C4D4  ali  26  369.ARLHLPEDIPFLHLEFTSFYYPGDFDFPLPPPILMVHMNPLTVWLDVLTLVWINAFILNLQKSLESLQA--SLDIEKSETFYADIKLEMLMPRIVCGARMTHKIKSSKPSSLQIHASKISIANYRSLETGSRADLVTVLELFQQSPLFFG--AEFPSRPQDVSIVCQKFVSHA. 538
67 1.000e-47UniRef50_S9W728 UHRF1 binding protein 1-like protein n=2 Tax=Boreoeutheria TaxID=1437010 RepID=S9W728_CAMFR  ali  94  149.............................VPSPNLYSQLNALQFTVDERSILWLNQFLLDLKQSLNQFMAVYKLNDNSKSDEHVDIRVDGLMLKFVIPSEMKSECHRDQPHAVSIQSSEMIATNTRHCPNCRHSDLEALFQDFKDCDFFSKTYTSFPKSGDNFNLLHPIFQRHAY 294
68 2.000e-47UniRef50_A0A182G5L3 Uncharacterized protein n=1 Tax=Aedes albopictus TaxID=7160 RepID=A0A182G5L3_AEDAL  ali  23  508RDRYSLPPEMPTLHAEFTYFYYPGDFVFPLPPSKAFVHINPVQINFDLDSCLWFSSFVLNLHESLLRTNNVTSSSEPQPNLMYMDVKVEVIMPRVIFEASPGAPQQRDRPKEMHVQVARCALTNIREMG-ASRADLAQAISSLQEGSLVFGSG--FPSKPGDLCIVTDRILSH.. 689
69 2.000e-47UniRef50_A0A1J1INW9 CLUMA_CG014454, isoform A n=1 Tax=Clunio marinus TaxID=568069 RepID=A0A1J1INW9_9DIPT  ali  27 2979KERFSFPPEMPTVHAEFTYFYYPGDFVFPLPPTKCFVYLNPIQVNFDVDSCLWFASFGLGLHESLMTTMNSPTTNSVEPSLMYMDVKLEAIMPRLIFESSRDVSAQKDRPKNMQIQVSRFAVTNIREMG-ASRADLAQAIHSLQEGTLVFSSG--FPSKSDDLSIVTDRILSH.. 3154
70 5.000e-47UniRef50_UPI0008116CE1 UHRF1-binding protein 1-like isoform X1 n=4 Tax=Rhagoletis zephyria TaxID=28612 RepID=UPI0008116CE1  ali  28  387KERYSFPSDMSIVHAEFTYFYYPGDFIFPLPPSKVFVHINPLQVHFDLSSVLWLNSFALNLHESLLRTSVGSAQQQEEPNLMYMDVKIEAIMPRVVIESTVDVPNQKDRPRIMQIQISRFAITNIREMG-SSRADLAQALHSLQEGSLVFG--TEFPSMSGDMCIVTDRILSHV. 602
71 1.000e-46UniRef50_A0A2D0SH32 UHRF1-binding protein 1 n=1 Tax=Ictalurus punctatus TaxID=7998 RepID=A0A2D0SH32_ICTPU  ali  40  474RKVLNMAENTPAIHLQFTEYYFPHHAAGPVPCSNLYGQLNGLQLCVDAASVLWMYVFCRGLLTTLEQVKAFYHLQDSSKSDEHVDVRVDATQLKLIIPLDSSILDHADRPHALGFTLSQAFLSNTHHSPHSSFSDLESTFSDFSAQPFFASPVSPFPRDRNTLHPLPLAFLK... 646
72 2.000e-46UniRef50_A0A182QQN3 Uncharacterized protein n=1 Tax=Anopheles farauti TaxID=69004 RepID=A0A182QQN3_9DIPT  ali  22  467.DRDRVPPDMATLHAEFTYFYYPGDFVFPLPPSKAFVHINPVQVHFHLDSLLWLSSFVLNLHESLLRTNNVTSAAEQQPNIMYMDVKVECIMPRLIFEASPGAPQQRDRPKAMHVEVSRFALTNIRE-TGSSRADLAQAISSLQEGSLVFGSG--FPSKPGDLCIVTDRILSH.. 649
73 3.000e-46UniRef50_UPI0009E43F3B UHRF1-binding protein 1-like n=1 Tax=Orbicella faveolata TaxID=48498 RepID=UPI0009E43F3B  ali  30  520KKALYLPSDMPAFQLDFTQYYYPGSIGSAVPCPNLFIQLNPIQLTVDTATCLWFNKFMQSILG--QRTWSIGAPQQSNPPSSHIDIRIEALMPKIIIPSEPCAAYKDSRPQALQIQMSQVFITNSRTGYKSTQTDMLMFLHPFLGSRIY-TDFENFPSISGDVQPLPNSSW.... 689
74 3.000e-46UniRef50_A0A2B4SLN8 UHRF1-binding protein 1-like n=3 Tax=Stylophora pistillata TaxID=50429 RepID=A0A2B4SLN8_STYPI  ali  27  519KKALFLPSDMPAFQLDFTQYYYPGSVTSAVPTPNLFIQLNPIQLTLDTATCLWFSSFMRSILGQRTWSKGSPEQATSGSPSDHIDIRIEALMPKLVIPCPSDPCAKDSRPQGLQVQMSQVFITNSRIGNKSTQTDMLMFLQPFLGARTY-SDFQNFPSLPSDVQPLPNSSW.... 690
75 5.000e-46UniRef50_A0A210Q3C5 UHRF1-binding protein 1-like n=2 Tax=Mizuhopecten yessoensis TaxID=6573 RepID=A0A210Q3C5_MIZYE  ali  31  508KKQLHLPSDMSVLHMEYTDYFFPEGINYPVPHANLYMLVNPIRLNLDYLTLLWVNFFMLNLSQSVTPEM------LDDTPKQHVDIKIEALMPRVIVSAEKKVESQPDRPEGVQLQVSKICVTNTHVEEHTGRADLAEVLRQYKDGHLFTSL--QYPNNNNPLISLSPHFSMFAN 674
76 5.000e-46UniRef50_M9PEM2 Uncharacterized protein, isoform E n=77 Tax=Drosophila TaxID=2081351 RepID=M9PEM2_DROME  ali  25  531KDRYSFPAEMPIIHAEYTYFYYPGDFVFPLPPSKVFVHVNPIQVHFDLSSILWLNSFGLNLHESLLRTSVGSQSTEQEPNLMYMDVKVEAIMPRIVMEAALDAPSQKDRPKTMQIQVSRFALTNIREMG-SSRADLAQALHSLQEGSLVFGSG--FPSKEGDMCIVTDRILSHV. 728
77 6.000e-46UniRef50_A0A0K8VNH0 UHRF1-binding protein 1-like n=3 Tax=Dacini TaxID=43871 RepID=A0A0K8VNH0_BACLA  ali  28  218KERYSFPADMSVVHAEFTYFYYPGDFIFPLPPSKVFVHINPLQVHFDLSSILWLNSFALNLHESLLRTSVGTSQAEQEPNLMYMDVKIEAIMPRVVIESTVDVPNQKDRPKIMQIQISRFAITNIREMG-SSRADLAQALHSLQEGSLVFG--TEFPAVNGDMCIVTDRILSHV. 425
78 6.000e-46UniRef50_A0A182PLR1 Uncharacterized protein n=3 Tax=Anopheles TaxID=44484 RepID=A0A182PLR1_9DIPT  ali  22  525.DRDRVPPDMATLHAEFTYFYYPGDFVFPLPPSKAFVHINPVQVHFHLDSLLWLSSFVLNLHESLPSTPSSASDSEQQPNIMYMDVKVECIMPRLIFEASPGAPQQRDRPKAMHVEVSRFALTNIRE-TGSSRADLAQAISSLQEGSLVFGSG--FPSKPGDLCIVTDRILAH.. 705
79 8.000e-46UniRef50_M9PC10 Uncharacterized protein, isoform G n=28 Tax=Schizophora TaxID=43738 RepID=M9PC10_DROME  ali  25  541KDRYSFPAEMPIIHAEYTYFYYPGDFVFPLPPSKVFVHVNPIQVHFDLSSILWLNSFGLNLHESLLRTSVGSQSTEQEPNLMYMDVKVEAIMPRIVMEAALDAPSQKDRPKTMQIQVSRFALTNIREMG-SSRADLAQALHSLQEGSLVFGSG--FPSKEGDMCIVTDRILSHV. 738
80 9.000e-46UniRef50_UPI000A2A8773 UHRF1-binding protein 1-like isoform X1 n=2 Tax=Exaiptasia pallida TaxID=1720309 RepID=UPI000A2A8773  ali  33  511KKALYLPSDMPAFQVDYTTYYYPVGVQSPVPNPNLFVQLNPVQVTLDTTTCIWFNRFLNAIFTSADSATCMQPQQPAKPS--HVDMRIEALMPRVTLPCPSEPGCHYRRPQALQIQMSQVALTNSRVGSNTSQTELLMLLQQFSSSKLY-TEYSXFPNELNDVRPLSNLAWL... 681
81 1.000e-45UniRef50_E9GHV3 Uncharacterized protein n=19 Tax=Daphnia TaxID=6668 RepID=E9GHV3_DAPPU  ali  25  487RGRFPLPDSTPIVHMEFTQFYYPGDMEFPLPQPKCFVQLNPLQVNFDGLTILWLHTFIRGLEKNLISCAPSTGAKSSSGPVPQLEIRLEALMPRMIFELP-----GWERPRSLQLQVSRLVCSNYRSIDNGSRADLAACLEKIQGGSSECGGASAFPARDDDLSPISETLLKHA. 664
82 1.000e-45UniRef50_A0A0K2UJH7 AGAP008379PAlike [Tribolium castaneum] n=2 Tax=Lepeophtheirus salmonis TaxID=72036 RepID=A0A0K2UJH7_LEPSM  ali  30  500.......DEMPVLHLEYSQFYYPGDDDFPLPPPKMYSFVNPIQVYLDPLTCLWLNAFTLNLQQSV------KSLSTESPEPPYLDVKIEAILLKIIYEDLQEYSDQPERPRSLEIQVSRVLAANYRSSETGTISELNKTLKIFSSSDLFNSF--KFPNEESDLNVICQKF..... 654
83 2.000e-45UniRef50_A0A087U0S3 UHRF1-binding protein 1-like protein (Fragment) n=1 Tax=Stegodyphus mimosarum TaxID=407821 RepID=A0A087U0S3_9ARAC  ali  30  431.KNAHMPSDIKTIHLEQTSYYLPGEIDFPVPSPNLFLHFGPLKLYLDTPTILWINAFYLNLQKCLMSMK-----TGVPETPSYVNIRAEALLPQVVIPTDVNSPTQPDRPRTVQLLSSRAIATNCRLGDHTTRSDLKECLQALSADEMF-SNTSKFPWKK-DKKPIPQALFNHV. 596
84 2.000e-45UniRef50_A0A1I8QCJ5 Uncharacterized protein n=42 Tax=Schizophora TaxID=43738 RepID=A0A1I8QCJ5_STOCA  ali  28  545KDRYSFPAEMPIIHAEFTYFYYPGDFIFPLPPSKVFVHINPLQIHFDLCSILWLNSFALNLHESLLRTSIAVSPTNSEPNLMYMDVKVEAIMPRIVIESSLETANQKDRPKMMQIQISRFALTNIREMG-SSRADLAQALHSLQEGSLVFGTG--FPSARGDMCIVTDRILSHV. 750
85 2.000e-45UniRef50_A0A0P4XX95 UHRF1-binding protein n=4 Tax=Daphnia magna TaxID=35525 RepID=A0A0P4XX95_9CRUS  ali  24  253RGRFPLPDSTPIIHMELTQFYYPGDVEFPLPQPKCFIQLNPLQLNFDGLTILWLHVFIRGLEKTLTSRTPSPGVPDSPMPEPQLEIRLEALMPRMIFELP-----GWERPRSLQLQVSRLVCSNYRSIDSGSQADLAACLEKIQGCPGGLCFASTFPAKDNDLSPISETLLKHA. 430
86 3.000e-45UniRef50_B4JR18 GH13078 n=5 Tax=Schizophora TaxID=43738 RepID=B4JR18_DROGR  ali  26  526KDRYSFPADMPIVHAEYTYFYYPGDFVFPLPPSKLFVHINPLQLHFDLSSILWLNSFGLNLHESLLRTSVGSQATLQQPNLTYMDVKVEAIMPRVVMEAALDAPNQKDRPKTMQIQISRFALTNIREMG-SSRADLAQALHSLQEGSLVFGSG--FPSVEGDMCIVTDRILSHV. 727
87 5.000e-45UniRef50_B4N0L5 Uncharacterized protein n=19 Tax=Schizophora TaxID=43738 RepID=B4N0L5_DROWI  ali  27  532KDRYSFPAEMPIVHAEYTYFYYPGDFVFPLPPSKIFVHVNPLQVHFDLSSILWLNSFGLSLRESLQRSQTQPEVDLEEPSLMYMDVKVEAIMPRVVLEAAVDAPNQKDRPKTMQIQISRFALTNIREMG-SSRADLAQALHSLQEGSLVFGS--EFPSNEGDMCIVTDRILSHV. 731
88 9.000e-45UniRef50_A0A0A9WS61 UHRF1-binding protein 1-like protein n=1 Tax=Lygus hesperus TaxID=30085 RepID=A0A0A9WS61_LYGHE  ali  31  476RDRYTFPAE-STIHAEFTYYYYPGDIAFPLPSPKFYVQINPVVLNFDAYTVLWLNAFALNLHHSLKKANQENSTEA---PLNYIDVRLEAIMPRVIFESAVDTQCQRDRPKSLHIQISRALISNVRSSDGCSRADLSRCINACQMGSLFLG........................ 623
89 1.000e-44UniRef50_UPI000BA804E2 UHRF1-binding protein 1-like n=1 Tax=Limulus polyphemus TaxID=6850 RepID=UPI000BA804E2  ali  29  430RTTILLPPDMKAVHLEMTYYYFPGDLDFPVPSPYVHMHLGPVYGTYDSQTVLWLNAFFLNIQNS----MVPAAPPPPVASPPSVDVRFEALMSKVIFPCDQSYPHQLEWPQALHLQASRIVATNRRLGDHASKSHLSQCLETFSEGTLLYENNT-YPWRMGDFKPIPEGLLEYV. 598
90 1.000e-44UniRef50_Q5TQB3 AGAP008379-PA (Fragment) n=20 Tax=Culicidae TaxID=7157 RepID=Q5TQB3_ANOGA  ali  22  525.DRDRVPPDMATLHAEFTYFYYPGDFVFPLPPSKAFVHINPVQVHFHLDSLLWLSSFVLNLHESLLRTNNVTSDAEQQPNIMYMDVKVECIMPRLIFEASPGAPQQRDRPKAMHVEVSRFALTNIRE-TGSSRADLAQAISSLQEGSLVFGSG--FPSKPGDLCIVTDRILSH.. 707
91 2.000e-44UniRef50_A0A0N1IN97 UHRF1-binding protein 1-like n=2 Tax=Papilio machaon TaxID=76193 RepID=A0A0N1IN97_PAPMA  ali  27  23.EKATLPGDAGLLHAELTFFYYPGDVCFPVPSPKLYVQLSPVRVSVDVPSVVWLSAFLPHVGRALATATAAEDQTS------YIDVRTEAIMPKLVLEAGPEHSQQRDRPKELHICTARATFTNVRESPRSNTAGTRADLASIISCLRRAAPHGQFPCMPDDLDPIHEQFLLHA. 191
92 7.000e-44UniRef50_A0A0L8GK64 Uncharacterized protein n=3 Tax=Octopus bimaculoides TaxID=37653 RepID=A0A0L8GK64_OCTBM  ali  34  525KRVLHLPQDMPILHMEFTEYYYPEGVNLPVPHANLYVLLNPVQLRVDYLTLLWLNYFVLQLSKNLKE--------NTDGPREHIDIKFEALMPKLLIPAESGSYPQAERPDTLLVQISKMSATNKQSEEDTSHEKLLLALEEQSQCCLLKS--TEFPMDQNELLVCPQHVCSHV. 689
93 7.000e-44UniRef50_A0A2A4J2U9 Uncharacterized protein (Fragment) n=1 Tax=Heliothis virescens TaxID=7102 RepID=A0A2A4J2U9_HELVI  ali  26  490.EKATLPGDAGLLHAELTFFYYPGDVCFPVPAPKLYVQLSPVRVSMDVNSVVWLGAFLPHL--------VPRGQDMEEAPPAYMDVRMEAIMPKVVLEAGSEHSQQRDRPKELHICTARATLTNVRESPRGTRADLAAILSALRRAQ---PPRGQFPCAHDDIDPIHEQFLLHA. 656
94 1.000e-43UniRef50_A0A2A4IZW2 Uncharacterized protein (Fragment) n=9 Tax=Noctuidae TaxID=7100 RepID=A0A2A4IZW2_HELVI  ali  26  466.EKATLPGDAGLLHAELTFFYYPGDVCFPVPAPKLYVQLSPVRVSLDVNSVVWLGAFLPHL--------VPRGQDMEDAPPAYMDVRMEAIMPKVVLEAGSEHSQQRDRPKELHICTARATLTNVRESPRGTRADLAGILSALRRAQ---PPRGQFPCAHDDMDPIHEQFLLHA. 632
95 1.000e-43UniRef50_UPI000BB004DD LOW QUALITY PROTEIN: UHRF1-binding protein 1-like n=1 Tax=Crassostrea virginica TaxID=6565 RepID=UPI000BB004DD  ali  32  508KKHLHLPPDMSVIHAEFTDYFFPEGID------SLYLMLNPIRLNLDWLTLLWANFFMLNLSKSIER------IELDDTPLEHVDMKIEAIMPRIVVPVEDKKCTLPDFPSSIQLQVSRVCATNTRISGQASRESLAEIITNYTTCSLFSSL--DFPNENNSLRAIPDSFNNHA. 672
96 9.000e-43UniRef50_UPI000454B774 UHRF1-binding protein 1 n=1 Tax=Ornithorhynchus anatinus TaxID=9258 RepID=UPI000454B774  ali  48  16.........................SPFLVPCPNLYVQLNGLTFTLHPISLLWGNLFSLDLYRSLRHFKAIYKLEDSSQQDEHLDTRLDAFQVKVSIPLEKRDQAGPQRPQALAISASAMTATNTRHAPHCSHLDLQNLFRRFAAAEFFHPTYARFPKAAGGFGLLHPLFLHHA. 164
97 9.000e-43UniRef50_A0A182LS17 Uncharacterized protein n=4 Tax=Anopheles TaxID=44484 RepID=A0A182LS17_9DIPT  ali  21  1.........MATLHAEFTYFYYPGDFVFPLPPSKAFVHINPVQVHFHLDSLLWLSSFILNLHESLPSTPSSASDTEQQPNVMYMDVKVECIMPRLIFEAASGAPQQRDRPKTMHVEVSRFALTNIRE-TGSSRADLAQAISSLQEGSLVFGSG--FPSKPGDLCIVTDRILSH.. 173
98 1.000e-42UniRef50_H9JIC9 Uncharacterized protein n=9 Tax=Obtectomera TaxID=104431 RepID=H9JIC9_BOMMO  ali  26  442.EKATLPGDAGLLHAELTFFYYPGDDCFPVPAPKLYVQLSPVRVSLDVNSAVWLGAFLPHVAGALAPPRRGAADPDTPPPAPYMDVRMEAIMPKIVLEAGSEHSQQRDRPKELHVCTARAMLTNVRESPRGTRADLAAILSALRRAT---PPRGEFPASTEDLDPIHEQFVLHA. 616
99 5.000e-42UniRef50_A0A212FBB8 Uncharacterized protein n=3 Tax=Nymphalidae TaxID=33415 RepID=A0A212FBB8_DANPL  ali  26  489.EKATLPGDAGLLHAELTFFYYPGDICFPVPAPKLYVQLSPVRVSVDVTSLLWLTAFLPHVGAAVVHTDDDSS--------SYMDVRAEAIMPKIVLEAGPEHSQQRDRPKELQICTARATITNIRESPRANTAGTRADLACIIASRERAPPRGKFPTSTQDMDPVHENFVLHAE 656
100 1.000e-41UniRef50_A0A1B0C8X5 Uncharacterized protein n=1 Tax=Lutzomyia longipalpis TaxID=7200 RepID=A0A1B0C8X5_LUTLO  ali  25  405KDRYSFPTELSAVHAEFTYFYYPGDFVFPLPPSKIFVHINPVQIHFDVDSLLWLSSFGLNLHNSLMRTSVVDSMNAASPPGGANEPSLIWRQSSHGLSLSQILMFHRTGSSEMQIQISRTSVTNIREMGT-SRADLAQALHSLQEGSLVSSSG--FPSKEGDLCIVTDRILSHV. 576
101 3.000e-41UniRef50_T2MK71 UHRF1-binding protein 1-like n=1 Tax=Hydra vulgaris TaxID=6087 RepID=T2MK71_HYDVU  ali  29  454KEALYLPKEMPAIYIDHSMYYYAQNVNLPVPLANMFISLNPIQLTFHPLTCVWLNRFSQSVIAGLDWTKEL--ISREPGFAEHIDIRLEALMPKINIPLEFPDLFHTERPKSMQIQISQAIVSNCRVGDKCTQPDILNDLQSFISSRNYADMNC-FPNMESDVTPLSNSTWL... 624
102 7.000e-41UniRef50_A0A2M4BBQ7 Putative uhrf1-binding protein 1 n=3 Tax=albitarsis series TaxID=58233 RepID=A0A2M4BBQ7_9DIPT  ali  22  1.........MATLHAEFTYFYYPGDFVFPLPPSKAFVHINPVQVHFHLDSFLWLSSFVLNLHESLLRTSNVTSGAEHQPNIMYMDVKLECIMPRVVFEASPGAPLQRDRPKSMHVEVSRFALTNIRE-TGASRADLAQAISSLQEGSLVFGSG--FPSKPGDLCIVTDRILSH.. 173
103 8.000e-41UniRef50_W5JN72 Uncharacterized protein n=7 Tax=Nyssorhynchus TaxID=44543 RepID=W5JN72_ANODA  ali  21  1.........MATLHAEFTYFYYPGDFVFPLPPSKAFVHINPVQVHFHLDSFLWLSSFVLNLHESLLRTSNVTSGAEHQPNIMYMDVKLECIMPRVIFEASPGAPLQRDRPKSMHVEVSRFALTNIRE-TGASRADLAQAISSLQEGSLVFGSG--FPSKPGDLCIVTDRILSH.. 173
104 6.000e-40UniRef50_A0A0P5VDM8 Putative UHRF1-binding protein n=1 Tax=Daphnia magna TaxID=35525 RepID=A0A0P5VDM8_9CRUS  ali  25  1..............MELTQFYYPGDVEFPLPQPKCFIQLNPLQLNFDGLTILWLHVFIRGLEKTLTSRTPSPGVPDSPMPEPQLEIRLEALMPRMIFELP-----GWERPRSLQLQVSRLVCSNYRSIDSGSQADLAACLEKIQGCPGGLCFASTFPAKDNDLSPISETLLKHA. 164
105 7.000e-40UniRef50_UPI00094EB62E UHRF1-binding protein 1-like n=1 Tax=Hippocampus comes TaxID=109280 RepID=UPI00094EB62E  ali  57  481............................TVPCPNLYAQLNALQLVLDHRSLVWLNLFALDLRQSLEQFMEIYKLNDSQKPDEHVDIKVDGLMLKVVIPADRDPSCPPNLPRSVSVQTSEMVATNTRHPANCTRAHLEALLQAFQGEPFFSSSFVSFPRLSSSVPLLHPVFRYHAH 627
106 3.000e-39UniRef50_A0A226E5X9 UHRF1-binding protein 1-like n=1 Tax=Folsomia candida TaxID=158441 RepID=A0A226E5X9_FOLCA  ali  31  474...LERPKDISAVNMEFTWFYNPGGISFPCPSPKFYTQVNPLQIHLDVCTILWLNSFVTNIQSSIPQLNA----QQDGENGDYMDVRLELIMPKVVFEEKIRYHSYKERPTALQIQASRIIVSNYRSSETGTRSQLATAIVEIEK---------HFGLSDNGVSQIPSKLLLHS. 631
107 1.000e-38UniRef50_A0A2T7PK32 Uncharacterized protein n=2 Tax=Pomacea canaliculata TaxID=400727 RepID=A0A2T7PK32_POMCA  ali  36  455KKQLHLPADMSLLHMEYTDYYFPDGVDYPVPHANLYILVNPVRVTLDFLTLLWSQYFLFNLAQNV-----------------------------VIVPSEEKVEGQPDRPDALQLQISKLTASNCRVDDKLGRSDLQRALDRYYSSQLFHTS--EFPNDATHFRLSPWALEEHA. 597
108 1.000e-38UniRef50_UPI0005D0E30A UHRF1-binding protein 1-like n=3 Tax=Ditrysia TaxID=37567 RepID=UPI0005D0E30A  ali  26  248.ERATLPGDAGLLHAEMTHFYYPGDVCFPVPPPKLYAQLSPVRLCVDVESLIWLSAFLPHVASAL--------ISNSQPDVFYMDVRMEAIMPKIILEAGSEHSQQRDRPRELHVCTARANITNIRESNRSTRSDLASILSLLRRA---APPPGQFPGAP-PRGPLHELFTLHA. 413
109 2.000e-38UniRef50_UPI000C2536E7 UHRF1-binding protein 1-like n=1 Tax=Leptinotarsa decemlineata TaxID=7539 RepID=UPI000C2536E7  ali  29  456RGRTGLPKNTNIIHAEFIYYYYTTSFPFPLPPPKFYVQLNPITFVYDLESCLWLNAFGLNLFTSATDSRNEIQLS----SYTYVDVRIEAILLKVSFGNAFLQSNHQNRPKSLAIYVTKAVITNVRGFEESSRADLAKCLDSLHMGSLFFG--TDFPSDADDLYVVTQKFVDH.. 622
110 4.000e-38UniRef50_A0A1W2W1P2 UHRF1-binding protein 1-like n=4 Tax=Ciona TaxID=7718 RepID=A0A1W2W1P2_CIOIN  ali  34  465RKELLLPDDMPLGYVSITDYFYPDGRDYPAPHSNIFVRVNAPRVRVHWPSFLWCNQLALSTVRSVQKMLEDLGIPISSSDPDHVDIRVETLMPRIFIPSFKTTED-TNSPIGLEIQVSQSTITNCRYGENCSRSSLSKVLQSIKDSYIF-NNSGSFPCEPG-YDLDHTHHALHSH 639
111 1.000e-37UniRef50_D5KJJ2 UHRF1 binding protein 1 (Fragment) n=3 Tax=Laurasiatheria TaxID=314145 RepID=D5KJJ2_PIG  ali  50  1..............................PCPNLYIQLNGLTFTVDPVSLLWGNLFCLDLYHSLEQFKAIYKLEDPSQKDEHVDIRLDAFWLKVSFPLEKREQAGLHRPQALVFSASGMTATNTRHAPHCSCPDLQSLFRGFAAAEFFHSNYVQFPKVP............... 130
112 5.000e-37UniRef50_Q69HR3 Uncharacterized protein (Fragment) n=1 Tax=Ciona intestinalis TaxID=7719 RepID=Q69HR3_CIOIN  ali  34  155RKELLLPDDMPLGYVSITDYFYPDGRDYPAPHSNIFVRVNAPRVRVHWPSFLWCNQLALSTVRSVQKMLEDLGIPISSSDPDHVDIRVETLMPRIFIPSFKTTED-TNSPIGLEIQVSQSTITNCRYGENCSRSSLSKVLQSIKDSYIF-NNTGSFPCEPG-YDLDHTHHALHSH 329
113 1.000e-35UniRef50_A0A1B0GPF9 Uncharacterized protein n=1 Tax=Phlebotomus papatasi TaxID=29031 RepID=A0A1B0GPF9_PHLPP  ali  23  200...........................FSVPPSKIFVHVNPVQIHFDVDSLLWLSSFGLNLHNSLMRTSVVDSMSPNEPSLMYMDVKVEAILPRIVFESSIDAPSQRDRPKIMQIQISRASVTNIREMGT-SRADLAQALHSLQEGSLVFSSG--FPSKEGDLCIVTDRILSHV. 346
114 2.000e-34UniRef50_UPI000C6E840F UHRF1-binding protein 1-like n=1 Tax=Centruroides sculpturatus TaxID=218467 RepID=UPI000C6E840F  ali  28  4.............................VPTPNIFAHLGPLQLTYDETTLLWLNTFLLNLAKCIQEASNSSSSSFQSFLLS-LNIRTELLMPQIIIPSDKSYPKQVERPKALHLQASRIVMTNCRIGDHASHLHLSECLESLSHGSMFF-DRTSYPWREDDLNPIAERFMQ... 144
115 5.000e-34UniRef50_A0A2C9JX98 Uncharacterized protein n=1 Tax=Biomphalaria glabrata TaxID=6526 RepID=A0A2C9JX98_BIOGL  ali  32  707.........................KAFCFPHANMYVLVNPVRLTLDFLTLLWSNVFLLTLTNSLDL------DSNEQKPSEHVDIKIEMLMPRVIVPAEEKVEGQPDRPEAVQLQISKLVVSNLRTEEKMSREDLKKLLDEYKVARLF--SQTDFPNEDGEQRLIPSMFLEHA. 850
116 1.000e-33UniRef50_A0A1I8FZR0 Uncharacterized protein n=1 Tax=Macrostomum lignano TaxID=282301 RepID=A0A1I8FZR0_9PLAT  ali  23  244KRRHQLPASSLSVYIDYTQYYCPSSASVGVPSPSLYIHLNPMHVRLDTDTIIWLSAFADNLTKNLDRLQTD---NGARPEDPTVDILSEFSFPRVICPAKQERLDHPERPNSLELLATSASVSNCPHAD--MSDALSAALDRCDQAA-AHGNATEFPHAASDPRV.......... 407
117 3.000e-33UniRef50_A0A2P8ZL74 Uncharacterized protein n=1 Tax=Blattella germanica TaxID=6973 RepID=A0A2P8ZL74_BLAGE  ali  27  488............................QVPPPKFYVQVNPIQIHFDLCSCLWLNSFALNLHQSLLSSN--PEQQQAAASLMYIDVKLEAIMPRVVFEQTGEHPNQRDRPKSLHFQVSRATVTNVRSMEHSSRADLAKCTDN-----VRPSPPPHF................... 608
118 8.000e-33UniRef50_A0A267GEE1 Uncharacterized protein n=2 Tax=Macrostomum lignano TaxID=282301 RepID=A0A267GEE1_9PLAT  ali  23  476KRRHQLPASSLSVYIDYTQYYCPSSASVGVPSPSLYIHLNPMHVRLDTDTIIWLSAFAANLTKNLDKSLQVFNDNGARPEDPTVDILSEFSFPRVICPAKQERLDHPERPNSLELLATSASVSNCPHAD--MSDALSAALDRCDQAA-AHGNATEFPHAASDPRV.......... 657
119 3.000e-32UniRef50_F1KS96 UHRF1-binding protein 1-like protein n=1 Tax=Ascaris suum TaxID=6253 RepID=F1KS96_ASCSU  ali  24  446KSKASLPSDQPLVHLEFASFYHPATETMPMPPNATHLLLGPFSFLLDQRTIRWVLYAYEDINNALQCLDASLGTDY----IPKTDIRIDLLMPKVIIPLDGYGTRDARMPRRLVVSMSTVLATNC---ESAHSQDACSFFSSLSANIVDFVDATQLPLNASSFR........... 602
120 3.000e-32UniRef50_A0A2G8LJN7 Putative UHRF1-binding protein 1-like n=1 Tax=Stichopus japonicus TaxID=307972 RepID=A0A2G8LJN7_STIJA  ali  32  1..................................MFIQCNPLVFYLDFMTVLWLNQFCFNILQTLPDLEEFAPAADDEGED-HTDIRLDALMPKIIIPSEPEHPDQPDRPQELQIQVSKLTATNCRIGTNLNRPFLSKLLQSLNRHKL-VTDKSTFPGATADILLTPQVFWTHA. 140
121 7.000e-32UniRef50_A0A1L8H6U7 Uncharacterized protein n=3 Tax=Anura TaxID=8342 RepID=A0A1L8H6U7_XENLA  ali  36  449....QIPYSFSAIHFQYMEYYHLPGQNIPVPSPALYIQLHGLMLCLAVPSILWLNQFMLDMYQHIHQF-----AEESNKAREHRDVRLDGFNLKLNFPVVSPLCQVKERPHSIYAHLAVVTITNTRQGPGSTLYHLQQCFRLFASKPSFHCP----------LGPLHPIFLSHV. 603
122 1.000e-31UniRef50_A0A226NSP2 Uncharacterized protein (Fragment) n=4 Tax=Amniota TaxID=32524 RepID=A0A226NSP2_COLVI  ali  89  19KKSLYLPPEMPAIHIEFTEYYYPDGKDFPIPCPNLYGQLNALQFTLDERSILWLNQFVLDLKQSLIQFMAMYKLNDNSKSDEHVDVRVDGLMLK................................................................................. 112
123 3.000e-31UniRef50_A0A0V1B7A9 UHRF1-binding protein 1-like (Fragment) n=1 Tax=Trichinella spiralis TaxID=6334 RepID=A0A0V1B7A9_TRISP  ali  21  36RAVMKLPSDTPTLHVELTDFYTKERAHYPVPPSSSFLRLHPVRVFLDLRTIRWINYVFLKVNQSL---FSDSYTNEAMKNALHKDIYMDVMMPRVIVPLAPDVDWLQKVPTSMVLYSSRICLTNCLPDHSDTSHQLQQLVTEIEEQEM........................... 182
124 1.000e-30UniRef50_A0A0B2VGQ5 UHRF1-binding protein 1-like n=2 Tax=Toxocara canis TaxID=6265 RepID=A0A0B2VGQ5_TOXCA  ali  24  511KSKASLPSDQPLVHLEFAAFYHPATETMPMPPNATHLLLGPFSFLLDQRTIRWVLYVYEDINNALQSLDASLEMDY----IPRTDVRVDLLMPKIIIPLGECGTRDSRMPRRVLVSMSTVLATNC---ESVHSQDACSFFSSLSANVVDFIDSSQLPLNTASFR........... 667
125 1.000e-30UniRef50_A0A131XXP7 Uncharacterized protein n=2 Tax=Ixodes ricinus TaxID=34613 RepID=A0A131XXP7_IXORI  ali  22  456.....LPGE--ALHLELTYYYSPGSQPGGVPEPHLFAHLGPMALRVDLTTVLWAHAFLHSVRKCTEHLTCSNG-------AMPLAVRLELILPKVVLP-----QFDRERPRELHLATSRAIATNCP----STGTNLGPCLEALGAGPLFFETA-QFPWRPQDPPPVADRFFRES. 629
126 7.000e-30UniRef50_A0A1I7Z7V4 Uncharacterized protein n=2 Tax=Steinernema glaseri TaxID=37863 RepID=A0A1I7Z7V4_9BILA  ali  23  443KSRLSLPSNLPILHLEFCNFFYPASQSYPLPPSSTHIQLGPFNLLLDTQTVRWITYMLGDISAAL-----DGGLDVQGGEDVQIDLRLDMLMPKIIIPS-CAPEDDSRFPKRFVISTSTLALSNCLSCEPNT---LSGFLSNLTGGAIDFLESCE.................... 588
127 1.000e-29UniRef50_A0A0V0U8Q7 UHRF1-binding protein 1-like n=26 Tax=Trichinella TaxID=6333 RepID=A0A0V0U8Q7_9BILA  ali  23  508RAVMKLPSDTPTLHVELTDFYYPGTKTFTLPPSSSFLRLHPVRVFLDLRTIRWINYVFLKVNQSL---SSDSYTNEAMKNALHKDIYMDVMMPRVIVPLAPDVDWLQKVPTSMVLYSSRICLTNCLPDHSDTSHQLQQLVTEIEEQEM........................... 668
128 1.000e-29UniRef50_A0A1S4ED43 UHRF1-binding protein 1-like n=1 Tax=Diaphorina citri TaxID=121845 RepID=A0A1S4ED43_DIACI  ali  29  485.RRENVPGGDVLLHAEFTYYYYPGDIKFPLPSPKFYVQLNPIQIIFDLITLLWLNAFTLNLHKNLMSTQAVTQATSSSEDLMYFDVKIEAIMMKDRLNGRSTVSSQPGRPPDTARDVSRTTLHHTRSSEQGMFADLAKCIQ.................................. 630
129 4.000e-29UniRef50_A0A0D8XDI4 Uncharacterized protein n=1 Tax=Dictyocaulus viviparus TaxID=29172 RepID=A0A0D8XDI4_DICVI  ali  19  402RHLKSLPSDQFIFHFEFVNFMHPSSNILRAPAPISFLQLGPFSILFDRRTVRWCLYVVHNISTAFKQ-----SVDTEMEFPYHSDLRIDLLLPKIIISLPMPSIDDRRFPLRLLISFSTISLSNCIIGRNMPFEMLNDAITYMRQLDLLSGGH...................... 549
130 9.000e-29UniRef50_A0A016SAF7 Uncharacterized protein n=7 Tax=Chromadorea TaxID=119089 RepID=A0A016SAF7_9BILA  ali  27  445RHLRSLPNDQYIVHFEFANFNHPMSNTLPVPAPASFLQLGPFSILFDKRTLRWCLYIVHNISTAFEQ-----SLGFEMEPIPHSDVRIDLLMPKVIIPFPAPSSDDRRFPLRLLISFSTLSLSNTR................................................. 565
131 5.000e-28UniRef50_A0A0B1SPS1 Uncharacterized protein (Fragment) n=1 Tax=Oesophagostomum dentatum TaxID=61180 RepID=A0A0B1SPS1_OESDE  ali  26  269RHLRSLPNDQYIVHFEFANFIHPMSSTLPVPAPASFLQLGPFSILFDRRTLRWCLYVAHNLATALEQ-----SLGVDMEPIPHSDLRVDLLMPKVIIPFPTPPTEDRRFPMRLLVSFSTFSLSNTQ................................................. 389
132 5.000e-28UniRef50_UPI000C6F8190 UHRF1-binding protein 1-like n=1 Tax=Copidosoma floridanum TaxID=29053 RepID=UPI000C6F8190  ali  31  92..KFPLPEDVNIIHAEFTYYYYPGDLNFPLPPPKFYVQVKPIQINFDVCSCLWFNSFFLNLYHSL--LNNSNGMTHPSSDLMYFDVKIEAILPRIIFES............................................................................ 186
133 7.000e-28UniRef50_A0A085NI87 Uncharacterized protein (Fragment) n=3 Tax=Trichuris TaxID=36086 RepID=A0A085NI87_9BILA  ali  21  424REALKLPLDLPIIHAEMNDFYNLEQTDIPVPPSSRFVQVHPIRVHWHHRTFRWINYVLSQINSSL---FSHSTTTDALTNALHADVFIELTMPWIQLPLGSYSEYGGRMPMAIVIRATRVTLTNCIYAQSFDREGLIDFIADLERSYIFDRSKPSLPSDTEAYKL.......... 593
134 1.000e-27UniRef50_A0A1D1VY30 Uncharacterized protein n=1 Tax=Ramazzottius varieornatus TaxID=947166 RepID=A0A1D1VY30_RAMVA  ali  25  456KKDLHLPETSAAVHLEYIVHYYPPSAPFTAAPPHLHIFCNPVQMTLHPATIDWLTQVASDVFSGAAVSTSSFNLDELVIPP--ILCRYEALMPKIVCPVEFSQ-----RMLGLQIQSGKGVATNASVGRTRSLTDSLNTLETIEESRLHCTD--TFPSRSSDV............ 610
135 5.000e-27UniRef50_A0A1W0WL41 UHRF1-binding protein 1-like n=1 Tax=Hypsibius dujardini TaxID=232323 RepID=A0A1W0WL41_HYPDU  ali  22  443KKALHLPKHCAAFHLEYIVNYYPHEVPVHAPPHIMHLFCNPVQVTLDLPTLDWFTLVCAEMFSTKE---NESPLTFSEASIPEVVCRCELLLPKAVAPVELPESAMRDQSLGLQMQCGKLILTNTQTGRD--RSLAQSLASVNLHGKRILTPDAAFPSNLDDPDMVILAHLTH.. 613
136 3.000e-26UniRef50_UPI000BE1D8DE uncharacterized protein LOC111244937 isoform X1 n=6 Tax=Varroa TaxID=62624 RepID=UPI000BE1D8DE  ali  22  468...........AIFIDFTSYYYPGSSSDLEPPSYCYVNVGPNLVRFDVPTLLWSIAFIRSLLRNLFCFTNEVSTT---------NCRFEVYLTKVML-------------DEVVAQCSRIVCSNSREGISSSRAELKQALDAFSRGPLFFETN-KYPWSDGDLPLICPEFVNH.. 614
137 6.000e-26UniRef50_UPI000870A854 UHRF1-binding protein 1-like n=1 Tax=Galendromus occidentalis TaxID=34638 RepID=UPI000870A854  ali  22  449...........AIFIDFTSYYYPGSSSDLSPPPYCYVNLGPSIIRLDIPTLLWGVAFMRSIIRE-NLFIFSHETPITM-------CRVEIYLTKVMF-------------DEVVAQCSRIICSNSREGISSSRAELKQALDSFSRGPLFFETN-KYPWSDGDLRAVSQHIVNH.. 595
138 6.000e-26UniRef50_A0A2K6FJV3 UHRF1 binding protein 1 like n=1 Tax=Propithecus coquereli TaxID=379532 RepID=A0A2K6FJV3_PROCO  ali  72  411............................................................LRRRITELSHVYDYLIAKMCAFASWTRLIFFLFQLVIPSEMKSECHQDQPRAISIQSSEMIATNTRHCPNCRHSDLEALFQDFKDCDFFSKTYTSFPKSCDNFNLLHPIFQRHAH 525
139 1.000e-25UniRef50_A0A132ACE8 UHRF1-binding protein 1-like protein n=1 Tax=Sarcoptes scabiei TaxID=52283 RepID=A0A132ACE8_SARSC  ali  19  479.....LPGNVPPIYIEMINYFFHDSLDLPMPEPT------PLKINFEPLTIIWINAFFANLRNALLKLQQAFPMSENHSQAEP-NVRVEVFMPTVCCRLPNDNDFQFGY-DCLELKISKIVLYNCSYINRDYFRNLDNLIKQFSMNIDFFYEHSEYPWLDCDMRPISSKFIKKVN 644
140 1.000e-25UniRef50_L7LUR0 Putative uhrf1-binding protein 1 n=3 Tax=Rhipicephalus TaxID=426455 RepID=L7LUR0_9ACAR  ali  23  481.....LPGE--ALHLELTHYYSPGSAASSVPEPHLFAYLGPTALRLDLPTVLWGHAFLHSVHKCTAHLSCANGAS-------PLAVRVEMILPKVAVPQPEEHSSGGGESRELQLGCSRAVATNWRPADRG------ACLEALGRGPLFFET-TSFPWRPDDPPPVHPCFLQ... 671
141 2.000e-25UniRef50_A0A1V9XPN4 UHRF1-binding protein 1-like n=1 Tax=Tropilaelaps mercedesae TaxID=418985 RepID=A0A1V9XPN4_9ACAR  ali  26  450...........ALFIDFTSYYYPGSSSDLAPPPYCYANLGPNLIRLDVPTLLWSIAFVRSLLRE-NWFRVSGEIPTTS-------CRFEVYLTKVVF-------------DEVVAQCSRMICSNSREGISSSRAELKQALDAFSRGPLFFETN-KYPWSDGDLP........... 581
142 3.000e-25UniRef50_A0A0V1B793 UHRF1-binding protein 1-like n=4 Tax=Trichinella spiralis TaxID=6334 RepID=A0A0V1B793_TRISP  ali  22  481RAVMKLPSDTPTLHVELTDFYYPGTKTFTL---SIYHRFHRVAVFYDFETIRWINYVFLKVNQSL---FSDSYTNEAMKNALHKDIYMDVMMPRVIVPLAPDVDWLQKVPTSMVLYSSRICLTNCLPDHSDTSHQLQQLVTEIEEQEM........................... 633
143 5.000e-25UniRef50_A0A2D4N0A2 Uncharacterized protein (Fragment) n=2 Tax=Micrurus spixii TaxID=129469 RepID=A0A2D4N0A2_9SAUR  ali  48  2............................................................................SGKREEHIDIRLDGFILKVNIPVDKKVIDHQDRPQCLSMATSEVTATNTRHAPHCSCLALQNLFRRFAASEFFHSSYTKFPKFQDNFSLLHTLFLRHAY 100
144 7.000e-25UniRef50_A0A068XYA2 UHRF1 binding protein 1 n=6 Tax=Cyclophyllidea TaxID=6201 RepID=A0A068XYA2_ECHMU  ali  21  390.EMHKLPVKANLILIDLTQCFALGAIDATLPI-ILYAQVNPLHLKFDVDTMIWLNAFFLNVTTNLHSLFGESELFVEQETSLPLFCRAEALMPRAVFPLHPPPPNPWTGPSALVVQVDTVILTVPRPLTTSMAKTLEDCLDKLEKQLQREHTPPDLPRRFTDLKPLSPL...... 574
145 7.000e-25UniRef50_A0A0N4VEJ1 Uncharacterized protein n=1 Tax=Enterobius vermicularis TaxID=51028 RepID=A0A0N4VEJ1_ENTVE  ali  25  427KSKASLPSDQPLVHLELASFYHPATEAMPLPSNTVHLLLAPFVFLLDQRTVRWAAFIFQDISTAVKRT----GATFDVKDMPESDIRVDFLMPKVIIPLTACKTGDYRYPRRLIISMSTVLMTNCGSLHS............................................. 552
146 8.000e-25UniRef50_A0A293M0S5 Uncharacterized protein (Fragment) n=1 Tax=Ornithodoros erraticus TaxID=265619 RepID=A0A293M0S5_ORNER  ali  16  407...........AFHLEWGHFF-------GHPRPYVFVHIGPTFIRLDLPTLLWAHAFLQSVRKCMSEGGG------RSSDLPIMAVRIEALLPKVCLSGVCGSGNQD--PLEMHLRASRVVATNLRLGE----AHLGECLEALSAGPLLFET-SRFPWRPNDPRPISESLLH... 554
147 8.000e-25UniRef50_A0A2R5LM64 Putative uhrf1-binding protein 1 n=1 Tax=Ornithodoros turicata TaxID=34597 RepID=A0A2R5LM64_9ACAR  ali  17  407...........ALHLEWGHFF-------GQPRPYIFAHLGPTFIRIDLPTLLWAHAFLQSVRKCMGEWGGSNS------DFAVMAVRIEALLPKVCLSGVCGSGSQD--PLEIHLRASRVVASNLRLGE----AHLGECLEALSAGPLLFET-SKFPWRPHDPRPISESLLHH.. 555
148 1.000e-24UniRef50_T1KT23 Uncharacterized protein n=2 Tax=Tetranychus urticae TaxID=32264 RepID=T1KT23_TETUR  ali  22  421RKLLKFPRDIPAFYLEFNQFYYYEARTRPVPDPVLFANVAPVKILFDAPSLIWLNALQSNLHKPLMELKQII---PRSETNVTIFSRFEILMPTIIIPSTDAFQSSTYNIESIQINCSRAVITNSIKEPT-YLDRLNDSLVSMGSCSLFIE-RDKFPWIEGVPRPISSGFLK... 601
149 2.000e-24UniRef50_Q4S5P3 Chromosome 9 SCAF14729, whole genome shotgun sequence (Fragment) n=2 Tax=Percomorphaceae TaxID=1489872 RepID=Q4S5P3_TETNG  ali  50  482RKVLRLPDNVPAVHLQFTEYYFPDNPNISVPTSNLYAQVNGLQFTVDPPSVLWISLFSRGLLQALDQVKAFYHLQDSSKTDEHIDIRMDAAQLK................................................................................. 575
150 3.000e-24UniRef50_A0A293MG16 Uncharacterized protein (Fragment) n=1 Tax=Ornithodoros erraticus TaxID=265619 RepID=A0A293MG16_ORNER  ali  16  235...........AFHLEWGHFF-------GHPRPYVFVHIGPTFIRLDLPTLLWAHAFLQSVRKCMSEGGG------RSSDLPIMAVRIEALLPKVCLSGVCGSGNQDTGGAEMHLRASRVVATNLRLGE----AHLGECLEALSAGPLLFET-SRFPWRPNDPRPISESLLH... 382
151 3.000e-24UniRef50_UPI00077A2DC3 LOW QUALITY PROTEIN: UHRF1-binding protein 1-like n=1 Tax=Acropora digitifera TaxID=70779 RepID=UPI00077A2DC3  ali  38  424KKALYLPTDMPAFQLDFTQYYYPNSVNSPVPCPNMFIQLNPIQVTLDTATCLWFNNFIQNVIG--ERGCSTNSPEQVKQSSRHIDIRIEALMPK................................................................................. 515
152 4.000e-24UniRef50_A0A2G8LJL8 Putative UHRF1-binding protein 1-like n=1 Tax=Stichopus japonicus TaxID=307972 RepID=A0A2G8LJL8_STIJA  ali  35  58KKTFCLPDDVPSIHVEYTSFYFPNELDFPVPSPIMFIQCNPLVFYLDFMTVLWLNQFCFNILQTLPDLEEFAPAADDEGED-HTDIRLDALMPKL----EQAQTSHR------QVHVPGATA..................................................... 168
153 5.000e-24UniRef50_A0A267DKN5 Uncharacterized protein n=6 Tax=Macrostomum lignano TaxID=282301 RepID=A0A267DKN5_9PLAT  ali  25  462KARLQLPRNTVTAFVDFTEFFYPATVDAAAPLPCLYAHLSPLHLRLDFDTLIWLNAFSLKLSKNLEQLQI-----QSSGSSEPLHVLAESIFPRLLIPAQQPPQLHQVRPTVLEAQADSVTISN---------DPAGFADSLAAAISAADSSTGDFPGDP-DFDWLP........ 618
154 9.000e-24UniRef50_A0A1D1W7N0 Uncharacterized protein n=1 Tax=Ramazzottius varieornatus TaxID=947166 RepID=A0A1D1W7N0_RAMVA  ali  20  470KAEFDIPESVPAIDIAMTNYYYAKEVQWPVPKGSVFATTCPIRLSLDANTIDWMTLMGLHVLRSLEDMMETMRKPSNIKSL----LRVESNIPRIFFP--KSFANRRERQSGVLIQAASIVITNTSVGQSKIVDEALPTL--LRTNLFAHPTY--FPNMQGDWPLVINHFLSFSQ 643
155 1.000e-23UniRef50_G5E3C6 Putative uhrf1-binding protein 1 (Fragment) n=1 Tax=Pipa carvalhoi TaxID=191480 RepID=G5E3C6_9PIPI  ali  79  161....................................................................MAMYKLNDSSKSDEHVDIRVDGLMLKFIIPSQKKADCHHDQPEAISIQTAEMIATNTRQSPNCRRSDLEAIFQDFKDYDFFSKTFTSF-RSHENFDLLHPIFQRHA. 265
156 1.000e-23UniRef50_H3FDR9 Uncharacterized protein n=1 Tax=Pristionchus pacificus TaxID=54126 RepID=H3FDR9_PRIPA  ali  19  215.AKRKFPGEQFVLHAEFANFFHPMSDSLPVPPPLTHVQFGPFSLLFDKRTIRWILYVAHHLTVALSQVEA-----PDMEPLPVTDFKLDLLMPKVILRLPDPSSDSR-LPHRLTVSLSTLSISNRSTEEQNHFTLLDTHLMDYLHGLALPSGKD..................... 361
157 3.000e-23UniRef50_A0A1E1XJF6 Putative uhrf1-binding protein 1 (Fragment) n=1 Tax=Amblyomma sculptum TaxID=1581419 RepID=A0A1E1XJF6_9ACAR  ali  22  164.....LPGE--ALHLELTHYYSPGSAGGSVPEPHLFAYLGPTALRLDLPTVLWAHAFLHSVYKCTAHLSCANGVS-------PLAVRVEMILPKVAVP-----QFERERPRELRLGCSRAVATNWRPADRGT------CLEALGRGPLFFET-TSFPWLPSDPPPVHACFLQ... 352
158 9.000e-23UniRef50_UPI0005EFC2A7 UHRF1-binding protein 1-like n=2 Tax=Strongylocentrotus purpuratus TaxID=7668 RepID=UPI0005EFC2A7  ali  36  352KNTFHLPPEIPSIHVEYMSFYFPNELDFPVPAPVIYAQINPMQLRLDNTTLLWLNQFAFNVMQTLPEIDEIAPASQTSSGQDHIDIRVDALMQK................................................................................. 445
159 2.000e-22UniRef50_G5EE16 Uncharacterized protein n=1 Tax=Caenorhabditis elegans TaxID=6239 RepID=G5EE16_CAEEL  ali  20  450RHLHSLPSDQQIVHVEFGAFYHPHSDKLPVPNSAVYFQLGPFTISFDERTMRWCCYVAHALSSAIEDGNLIPENELDIQPPT---IKVNLVMPRLVLNLPGPFTD-FNFPRRLV............................................................. 559
160 2.000e-22UniRef50_A0A1E1W0B1 Uncharacterized protein (Fragment) n=1 Tax=Pectinophora gossypiella TaxID=13191 RepID=A0A1E1W0B1_PECGO  ali  25  17..................................................................................YMDVRAEAIMPKIVLEAGPEHSQQRDRPKELHICTARATITNVRESPRGTRADLAAILSALRRS---APSRGQFPCTADDLDPIHEQFILHA. 110
161 7.000e-22UniRef50_A0A158QGG6 Uncharacterized protein n=1 Tax=Hymenolepis nana TaxID=102285 RepID=A0A158QGG6_HYMNN  ali  22  426..MHKLPVKTNLIAVDFTQCLSPESPNTVLPM-ILFAQINPLHIKFDVDTMIWLNAFLLNLTANLQSLFDEAETSEHQTTPPPLFYRVESLMPRVILPMVPPPCNPWTGPSALVMQIDQVILTVPPPITAPMTKALSALLDKLKKQR............................ 580
162 9.000e-22UniRef50_A0A2G5T124 Uncharacterized protein n=6 Tax=Rhabditida TaxID=6236 RepID=A0A2G5T124_9PELO  ali  20  448RHLHSLPSDQQIVHVEFGTFYHPHSDKLPVPNSAVYFQLGPFTVSFDERTTRWCCYVVHALSSAIEDGNLIPEKDLDVRPPT---IKISLLMPRLVLNLPGPFTD-FNFPRRLV............................................................. 557
163 1.000e-21UniRef50_A0A0V0JA59 Uncharacterized protein n=4 Tax=Schistocephalus solidus TaxID=70667 RepID=A0A0V0JA59_SCHSO  ali  19  511.RMHKLPSSTDLISVDLTHYFTFDSPAEGLPL-VLFAYVNPMHVKFHTDTLIWLNAFITSLTVNLQSLFGDKEPLSDEVAFPPLFIRAEMLMPRVIFPLGEPSGYPWVGPTALVVQFDIATLQSLPHPPRAMSEELQLLLDRFEQSD............................ 664
164 1.000e-21UniRef50_A0A1X7VC54 Uncharacterized protein n=1 Tax=Amphimedon queenslandica TaxID=400682 RepID=A0A1X7VC54_AMPQE  ali  22  485KETFNLPNDIPAFQCGITTYYYPEGNRFLVPRPNIFIYISPIHVNFHQEQCLWLAEFVQGVAQTVNLLQELKAKRDVVNKLNGVDMKFYLPYSKITLPVNEVSTDG--RPRALQIETGGITV------ENHTLLFLIKDETFLKASGWFPNSQNQFPHSSNDPSLLPSNLVE... 670
165 8.000e-21UniRef50_A0A1I7SQH3 Uncharacterized protein n=1 Tax=Bursaphelenchus xylophilus TaxID=6326 RepID=A0A1I7SQH3_BURXY  ali  24  463.ARQTLPKQTPIFHMELASYYYLNPTSFPVPPNASHLIIGPLIIGVDPRSIRWLVYVSENISNVV-------DVKNLQKDPTPTDTRIEILLPHIYFDLHVPEDDDR-FPNKLSASLCTVTATNY-HYEQTPISDTVAFKQFSEKATEFMKNYDE.................... 607
166 1.000e-20UniRef50_A0A0V0XV50 UHRF1-binding protein 1-like n=1 Tax=Trichinella pseudospiralis TaxID=6337 RepID=A0A0V0XV50_TRIPS  ali  25  458RAVMKLPSDTPTLHVELTDFYTKERTHYPVPPSSSFLRLHPVRVFLDLRTIRWINYVFLKVNQSL---FSDSYTNEAMKNALHKDIYMDVMMPRV................................................................................ 549
167 2.000e-20UniRef50_A0A0V1B7A4 UHRF1-binding protein 1-like n=3 Tax=Trichinella TaxID=6333 RepID=A0A0V1B7A4_TRISP  ali  22  481.............................LPPSSSFLRLHPVRVFLDLRTIRWINYVFLKVNQSL---FSDSYTNEAMKNALHKDIYMDVMMPRVIVPLAPDVDWLQKVPTSMVLYSSRICLTNCLPDHSDTSHQLQQLVTEIEEQEM........................... 598
168 3.000e-20UniRef50_E4YDI6 Uncharacterized protein (Fragment) n=1 Tax=Oikopleura dioica TaxID=34765 RepID=E4YDI6_OIKDI  ali  29  220.KKLNLPSEIPLFHYEATEYYTPDGSDYVLPHNNQYIQVNAPVIDFDEETVIWMSKILKNASKCINEALVELGIDEDASTNDHVDMLVDIILPSINFG-------------ELHLEASSISLTN................................................... 331
169 5.000e-20UniRef50_A0A0V1J2J3 UHRF1-binding protein 1-like n=19 Tax=Trichinella TaxID=6333 RepID=A0A0V1J2J3_TRIPS  ali  22  502.............................LPPSSSFLRLHPVRVFLDLRTIRWINYVFLKVNQSL---FSDSYTNEAMKNALHKDIYMDVMMPRVIVPLAPDVDWLQKVPTSMVLHSSRICLTNCLPDHSDSSHQLQQLVTEIEEQEM........................... 619
170 5.000e-20UniRef50_A0A0V1G1B5 UHRF1-binding protein 1-like n=1 Tax=Trichinella pseudospiralis TaxID=6337 RepID=A0A0V1G1B5_TRIPS  ali  21  2..................HFFSP------VPPSSSFLRLHPVRVFLDLRTIRWINYVFLKVNQSL---FSDSYTNEAMKNALHKDIYMDVMMPRVIVPLAPDVDWLQKVPTSMVLHSSRICLTNCLPDHSDSSHQLQQLVTEIEEQEM........................... 124
171 1.000e-19UniRef50_A0A0N4U9Q3 Uncharacterized protein n=20 Tax=Chromadorea TaxID=119089 RepID=A0A0N4U9Q3_DRAME  ali  23  433.SKASVPPTEPLVHLEFTSFYHPA---IEMPSNVTHLLLGPFSFVFDQRTIRWILYVCNDIDKTLVKILQSSEVLLDIQNMPKTNFRIDALMPKVIVPLSSSSKADNRLPRRVVVSMSAVTAVN................................................... 565
172 1.000e-19UniRef50_E4WRZ6 Uncharacterized protein n=1 Tax=Oikopleura dioica TaxID=34765 RepID=E4WRZ6_OIKDI  ali  29  418.KKLNLPSEIPLFHYEATEYYTPDGSDYVLPHNNQYIQVNAPVIDFDEETVIWMSKILKNASKCINEALVELGIDEDASTNDHVDMLVDIILPSINFG-------------ELHLEASSISLTN................................................... 529
173 1.000e-19UniRef50_G4VHU2 Uncharacterized protein n=2 Tax=Schistosoma TaxID=6181 RepID=G4VHU2_SCHMA  ali  25  433KLLHNLPDTSSFLTIEFKNYYCPSSSNQSLPCS-LFCQINPFYINFDPDTVIWLNTFLLALQSNLSTFLCGRDMKNPSNDLNRYHVRLEALMPRLIFSLFGQSNRHTNGPHALILQSDQIIVQSLAAPISSHVADLKKLLDNLQLSYGQYDTSC..................... 603
174 2.000e-19UniRef50_A0A0D6LCQ1 Uncharacterized protein n=1 Tax=Ancylostoma ceylanicum TaxID=53326 RepID=A0A0D6LCQ1_9BILA  ali  29  412...........................FTIPAPASFLQLGPFSILFDKRTLRWCLYIVHNISTAFEQ-----SLGFEMEPIPHSDVRIDLLMPKVIIPFPAPSSDDRRFPLRLLISFSTLSLSNTR................................................. 505
175 2.000e-19UniRef50_T1HLZ7 Uncharacterized protein n=3 Tax=Cimicomorpha TaxID=33354 RepID=T1HLZ7_RHOPR  ali  25  552........................................................FLSNLLEKLEQIK-----QISSQSNVYVDPKI-SITTYLSFDSGENWGTERDRPRSLHIQVSRGLVSNVRSSDTCSRADLAKAIHAAQLGTLFLG--TEFPVKSTDFQVITDKFIDHVQ 662
176 2.000e-19UniRef50_A0A090N0Q3 Vacuolar protein sorting-associated protein 13A N-terminal domain-containing protein n=6 Tax=Strongyloidoidea TaxID=2082224 RepID  ali  22  450.....LPVDMGIIHFEYCTYEYGEDKTLPPPSPSAYVAIGPIEAKIDPRTIRWLVYIGDQL-KEVVPIDELNNLSSETSPGDEVVVRIEMISTKIILEQSCSHNMDERYPKEFFINIDKANITNCK................................................. 569
177 2.000e-18UniRef50_UPI000D09FEA6 UHRF1-binding protein 1-like n=1 Tax=Oncorhynchus tshawytscha TaxID=74940 RepID=UPI000D09FEA6  ali  51  627KKSLYLPPEMPAIHVEFTEYYFPDGKGLPIPCPNLYVAADPAQLVLDPGSLVWLQLFTLDLTAELEQFHGDSNASQRTEPDRHLDIRVDG..................................................................................... 724
178 3.000e-18UniRef50_UPI000C6EE620 UHRF1-binding protein 1-like n=1 Tax=Centruroides sculpturatus TaxID=218467 RepID=UPI000C6EE620  ali  39  510KVSLVLPADMKSIHLEMTYYYFPGDITLPVPTPNIFAHLGPLQLTYDETTLLWLNTFLLNLAKCIVSNVSLFLFNN................................................................................................... 585
179 5.000e-18UniRef50_UPI00065B5DA4 uncharacterized protein LOC101863599 n=1 Tax=Aplysia californica TaxID=6500 RepID=UPI00065B5DA4  ali  27  56............................................................................EDKPAEHKDIKVELLMPRVIIPAEEKVESQPDRPDALQLQISKLVVCNRRTEERMGREDLRTLLEQYASERLLSS--KEFPMDDQPEEWIPQLLFQHAN 158
180 7.000e-18UniRef50_A0A0S7G4K0 URFB1 n=1 Tax=Poeciliopsis prolifica TaxID=188132 RepID=A0A0S7G4K0_9TELE  ali  29  1.......................................................................................MDAAHLKLIIPLDSSILDHPERPQSLSVTVPQMVFSNTRNCPHGSTADLSNTCEKFASCPFFQSPPCPYPREPSVFHPVPSTFLRHAQ 89
181 2.000e-17UniRef50_UPI00077FC466 UHRF1-binding protein 1-like n=1 Tax=Parasteatoda tepidariorum TaxID=114398 RepID=UPI00077FC466  ali  37  183.KSAHMPSDIKTIHLEQTSYYLPGDFDFFVPSPNLFLHIGPLKLYLDTPTMLWINAFYLNLEKCL.............................................................................................................. 246
182 9.000e-17UniRef50_A0A0R3WPT8 Uncharacterized protein n=1 Tax=Hydatigena taeniaeformis TaxID=6205 RepID=A0A0R3WPT8_HYDTA  ali  21  4..........SLISIDLTQCFAHGISDVALPI-IVYAQVNPLHLKFDVDTMIWLNAFFLSLKTNLQSLFDDSDVSVASETMIPLFCRAEVLMPRVIFPMHPPPSNPWTGPSALVVQVDTVLLTIPKPLTTSMAKTLEECLDKLAKQS............................ 148
183 6.000e-16UniRef50_A0A261BDD8 Uncharacterized protein (Fragment) n=2 Tax=Caenorhabditis TaxID=6237 RepID=A0A261BDD8_CAERE  ali  25  396RHLHSLPSDQQIVHVEFGTFYHPASDQLPVPNSAVYFQLGPFTITFDERTTRWCCYVAHALSSAITKGFP......................................................................................................... 465
184 1.000e-14UniRef50_UPI00084B6DE4 uncharacterized protein LOC108673136 n=1 Tax=Hyalella azteca TaxID=294128 RepID=UPI00084B6DE4  ali  22  552......................................................NNFLPHTRHPNNSSPHTRHPNNSSPHTRHTTTFYTTLHPTVVLEASTEPVTQKDRPRGLQVQASRVTLSNCRPPDPSSLAALGATLEAQTTGQLFF--ASDFPARADDFLPVACKFVRHA. 681
185 2.000e-14UniRef50_A0A074ZVB5 Uncharacterized protein (Fragment) n=3 Tax=Opisthorchiidae TaxID=6196 RepID=A0A074ZVB5_9TREM  ali  22  473KKLHCLPESVYFLTVELNNIYYPSKQADTLPC-FFFAQLKPFYVRFDADTVIWLNMFLLTLHLNLYTLMRQTSLLSQDTEPKSYHLRCEALMPRLLLPLKPSSSVGLPGPDMLVLQADQLFIQLVPPVTTYTASVLRGLLAEQPSSSSFPNT....................... 638
186 9.000e-14UniRef50_A0A1Y3EPC0 Uncharacterized protein n=1 Tax=Trichinella nativa TaxID=6335 RepID=A0A1Y3EPC0_9BILA  ali  18  472RAVMKLPSDTPTLHVELTDFYTKQRAHYP-----------------GTKT------FTLSIYHR----SSDSYTNEAMKNALHKDIYMDVMMPRVIVPLAPDVDWLQKVPTSMVLYSSRICLTNCLPDHSDTSHQLQQLVTEIEEQEM........................... 594
187 2.000e-12UniRef50_A0A1I8AWE9 Uncharacterized protein n=1 Tax=Meloidogyne hapla TaxID=6305 RepID=A0A1I8AWE9_MELHA  ali  21  469....RMPQPLSFAHLEITSYSFPATDSYPVPPNSVHLMLAPFELIPDIKSVRWLIYAFENILNSFE----APHSRNDISDNKQVEIRIEMIMPKIMLN............................................................................. 558
188 5.000e-12UniRef50_A0A2H1VF75 SFRICE_008943 (Fragment) n=1 Tax=Spodoptera frugiperda TaxID=7108 RepID=A0A2H1VF75_SPOFR  ali  17  206............................................................VLTHFFRFINSHQSFHACSSVNGTFIFVQVRW--LVLEAGPEHSAQRDRPRELQLCTARATLTNVRESPRGTRADLASILAALRRS---APPRDQFPCAVDDMDPIHEQFILHA. 319
189 2.000e-11UniRef50_A0A1I8FZQ3 Uncharacterized protein n=1 Tax=Macrostomum lignano TaxID=282301 RepID=A0A1I8FZQ3_9PLAT  ali  37  296KRRHQLPASSLSVYIDYTQYYCPSSASVGVPSPSLYIHLNPMHVRLDTDTIIWLSA....................................................................................................................... 356
190 3.000e-11UniRef50_A0A0D2WUB8 Uncharacterized protein n=1 Tax=Capsaspora owczarzaki (strain ATCC 30864) TaxID=595528 RepID=A0A0D2WUB8_CAPO3  ali  23  509..LLNLPPGTPVLHADMVAYYIVAADQLSMPPSNVFFNLNPIQLVFDR--LQWLNVFMESITNMTAHLEPLPKRADDDES--RVVVRVELLLPKIILPPYAGHHGPPEASQVLSLSASKICVTN................................................... 650
191 3.000e-09UniRef50_T1EGI0 Uncharacterized protein n=1 Tax=Helobdella robusta TaxID=6412 RepID=T1EGI0_HELRO  ali  28  467KKRLILPQDMSTLHVDVTNYTSVGPSSEL--SSSMFITINPICLSVDYLSLVWLHTFILNVMKKAVSFLFLS....................................................................................................... 536
192 5.000e-08UniRef50_A0A2P4WR21 Uncharacterized protein n=1 Tax=Caenorhabditis remanei TaxID=31234 RepID=A0A2P4WR21_CAERE  ali  28  342RHLHSLPSDQQIVHVEFGTFYHPASDQLPVPNSAVYFQLGPFTIT.................................................................................................................................. 386
193 2.000e-07UniRef50_A0A2I0T8V0 Uncharacterized protein n=1 Tax=Limosa lapponica baueri TaxID=1758121 RepID=A0A2I0T8V0_LIMLA  ali  42  75......................................................................................................................RSSCVVVRVDDLDVHQDLQSLFRKFASSEFFHSSYTKFPRSQDNFSLLHTLFLRHAY 131
194 3.000e-07UniRef50_A0A2W1B580 Uncharacterized protein (Fragment) n=2 Tax=Helicoverpa armigera TaxID=29058 RepID=A0A2W1B580_HELAM  ali  26  310.EKATLPGDAGLLHAELTFFYYPGDVCFPVPAPKLWCWKQPPRGQF................................................................................................................................. 354
195 3.000e-07UniRef50_A0A183BVR1 Uncharacterized protein n=1 Tax=Globodera pallida TaxID=36090 RepID=A0A183BVR1_GLOPA  ali  25  451KSKDRMPHSMSFLHLELSSYAFPASNAFTVPPDSVHLVMAPLELSPDAKSIRWM......................................................................................................................... 504
196 2.000e-05UniRef50_A0A293LFN3 Uncharacterized protein (Fragment) n=1 Tax=Ornithodoros erraticus TaxID=265619 RepID=A0A293LFN3_ORNER  ali  16  491...............................................................................................................EMHLRASRVVATNLRLG----VAHLGECLEALSAGPLLFET-SRFPWRPNDPRPISESLLH... 546
197 3.000e-05UniRef50_A0A2R7WSW0 Uncharacterized protein n=1 Tax=Oncopeltus fasciatus TaxID=7536 RepID=A0A2R7WSW0_ONCFA  ali  19  2.........................................................................................................................LSNVRSADFCSRTDLAKCINAAQHGSLFYG--CEFPVKENDQVVITYKFIDHIN 53
198 3.000e-05UniRef50_A0A2J7PG81 Uncharacterized protein n=1 Tax=Cryptotermes secundus TaxID=105785 RepID=A0A2J7PG81_9NEOP  ali  20  1...............................................................................................................................MEHSSRADLAKCIDTYQLGSLFYG--ADFPALPDDYHVVTEKFLRHV. 45
199 1.000e-04UniRef50_UPI00094E391D UHRF1-binding protein 1-like n=1 Tax=Hippocampus comes TaxID=109280 RepID=UPI00094E391D  ali  79  102KKSLYLPPEMPAVHVEFTEYYFPDGKDYP.................................................................................................................................................. 130
200 2.000e-04UniRef50_G3SGL0 UHRF1 binding protein 1 like n=32 Tax=Boreoeutheria TaxID=1437010 RepID=G3SGL0_GORGO  ali  100  488KKSLYLPQEMSAVYIEFTEYYYPDGKDFP.................................................................................................................................................. 516
201 3.000e-04UniRef50_UPI0007AD5B90 UHRF1-binding protein 1-like n=1 Tax=Sinocyclocheilus grahami TaxID=75366 RepID=UPI0007AD5B90  ali  48  494RKSLHLPDNTPAIHLQFTEYYFPDNPGLP.................................................................................................................................................. 522
202 1.000e-03UniRef50_UPI0009B41510 UHRF1-binding protein 1-like n=1 Tax=Monopterus albus TaxID=43700 RepID=UPI0009B41510  ali  38  155RKALGLPDDIPAVHLQFTEYYLPDNPSLSD-KVHDHSQLHPVE.................................................................................................................................... 196
203 1.000e-03UniRef50_A0A2D4JUH7 Uncharacterized protein (Fragment) n=3 Tax=Micrurus TaxID=8634 RepID=A0A2D4JUH7_9SAUR  ali  73  1.................................................................................................................................................STFFSRTFTDFPKSSDCFNLLHPIFERHAH 30
204 0.003UniRef50_UPI000B98F0DF UHRF1-binding protein 1-like n=1 Tax=Nilaparvata lugens TaxID=108931 RepID=UPI000B98F0DF  ali  37  408RERYMLPTDLKTIHAEFTYYYYPGDIPFP.................................................................................................................................................. 436
205 0.004UniRef50_UPI000719D2EF UHRF1-binding protein 1-like n=1 Tax=Priapulus caudatus TaxID=37621 RepID=UPI000719D2EF  ali  41  218KKRLYLPPDLPVLHAEWNDYYFPAETNFP.................................................................................................................................................. 246

FFAS is supported by the NIH grant R01-GM087218-01
1 3 2 7 5 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Doctor KS, Reed JC, Godzik A., Bourne PE. The apoptosis database. Cell Death Differ. 2003 Jun;10(6):621-33. Review.