current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 2e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .
# Score Template Links and tools%idFirst MGSSSSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSGSYYNGISTNLLast
1 -118.0002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model  100  1MGSSSSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSGSYYNGISTNL 285
2 -115.0004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  98  1MGSSSSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLSFIQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 285
3 -99.0005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  98  2..................PALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLAFAQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 268
4 -94.7004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  98  1MGSSSSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLGNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPRPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 285
5 -92.5004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  97  1..................PALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMVAPNIFNYARKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFFQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCSVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 267
6 -91.3003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  96  2....KGGLVPRGSHGASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLTPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLVFWQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSALVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 282
7 -87.2004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  98  2..................PALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLANYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 268
8 -81.0002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  42  1MGSSSSGLVPRGSHMFLTRRDQYQRLKELNASGEQLEMGFSDRDRAFQGIEHQLMSQGKRHLEQLRTVKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEDHPLFSQVFWLDGKKCLRPMLAPNLYTLWRELERLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEHQRLEDMARWVLEAAGIEFELVTESSVVYGDTVDVMKGDLELASGAMGPHFLDEKWEIFDPWVGLGFGLERLLMIREGTQHVQSMARSLSYLDGVRLNI 301
9 -49.4003l4g_A mol:protein length:508 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  16  200.GSWRDRPFKPYNFLAHGVLPDSGHLHPLLKVRSQFRQIFLEMG--FTEMTDNFIESSFWNFDALFQPQQHPAR-----DQHDTFFLRDPAEALQLPMDYVQRVKRTHSQSQGYKYNWKLDEARKNLLRTHTTSASARALYRLAQKKPFPVKYFSIDRVFRNETLDATHLAEFHQIEGVVADHGLTLGHLMGVLREFFTKLGITQLRFKPAYNPYTEPHQGLKKWVEVGNSGVFRPEMLLPMGLPENVIAWGLSLERPTMIKYGINNIRELVGHKVNL....... 484
10 -46.2001b70_A mol:protein length:350 PHENYLALANYL-TRNA SYNTHETASE  ali model follow..  13  76.ALKEALERERVDVSLPGASLFSGGLHPITLMERELVEIFRALG--YQAVEGPEVESEFFNFDALNIPEHHPAR-----DMWDTFWLTG--------------------EGFRLEGPLGEEVEGRLLLRTHTSPMQVRYMVAH----TPPFRIVVPGRVFRFEQTDATHEAVFHQLEGLVVGEGIAMAHLKGAIYELAQALFGPDSRFQPVYFPFVEPGAQFGKWLELGGAGMVHPKVFQAVDAYRERLAFGLGVERLAMLRYGIPDIRYFFGGRLKF....... 342
11 -42.0002rhq_A mol:protein length:294 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  12  26.....QLAEETIDVTLPSRQISIGSKHPLTRTVEEIEDLFLGLG--YEIVDGYEVEQDYYNFEALNLPKSHPAR-----DMQDSFY-----------------------------------ITDEILMRTHTSPVQARTMEKRNG--QGPVKIICPGKVYRRDSDDATHSHQFTQIEGLVVDKNIKMSDLKGTLELVAKKLFGAEIRLRPSYFPFTEPSVEVTGWIEILGAGMVHPNVLEMAGFDSNGFAFGMGPDRIAMLKYGIEDIRYFYTNDVRF....... 276
12 -41.1003pco_A mol:protein length:327 Phenylalanyl-tRNA synthetase, alpha subunit  ali model follow..  10  82.ALNARLAAETIDVSLPGRRIENGGLHPVTRTIDRIESFFGELG--FTVATGPEIEDDYHNFDALNIPGHHPAR-----ADHDTFW-----------------------------------FDTTRLLRTQTSGVQIRTMKAQ-----QPPIRIIAPGRVYRNDYDQTHTPMFHQMEGLIVDTNISFTNLKGTLHDFLRNFFEEDLRFRPSYFPFTEPSAEVDKWLEVLGCGMVHPNVLRNVGIDPEGFAFGMGMERLTMLRYGVTDLRSFFENDLRF....... 322
13 -40.9002du3_A mol:protein length:534 O-phosphoseryl-tRNA synthetase  ali model follow..  15  22.AGKEILAERSPNELYPRVGFSFGKEHPLFATIQRLREAYLSIG--FSEVVNPLIVEDVHVKKQFGREAAITKREVDSKPLQEIFHRYKKGEIDGDVLDVDDITAVKILDEVFPEFKELKPISSTLTLRSHMTTGWFITLSHIADKLPLPIKLFSIDRCFRREGEDATRLYTYFSASCVLVDEELSVDDGKAVAEALLRQFGFENFRKDEKRSKYYIPTKYSDGWIEIATFGIYSPTALAEYDIPYPVMNLGLGVERLAMILYGYDDVRKMVYPQIHG....... 353
14 -40.6005x6c_A mol:protein length:553 O-phosphoserine--tRNA(Cys) ligase  ali model follow..  14  47............DNKYPRLKPVYGKPHPVMETIERLRQAYLRMG--FEEMINPVIVDEMEIYKQFGPEAMAVLLGIDIDEEKKERLREVLHLYKKGAIDGDDLVFEIAKALNVSEFKDLKPESTTLTLRSHMTSGWFITLSSLIKKRKLPLKLFSIDRCFRREQEDRSHLMSYHSASCVVVGEDVSVDDGKVVAEGLLAQFGFTKFKFDEKKSKYYTPETQTGEWIEVATFGVYSPIALAKYNIDVPVMNLGLGVERLAMIIYGYEDVRAMVYPQFYE....... 361
15 -39.4003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  18  2..................................AMGTLEAQTQGPGSMQKNMVETEPVQGCRDFPPEAMR-CRRHLFDVFHATAKTFGFEEYDAPVLESEELYRKAGEEITEQMFNFITKGGHRVALRPEMTPSLARLLLGKGRSLLLPAKWYSIPQCWRYEAITRGRRREHYQWNMDIVGVKSVSAEVECAACWAMRSLGLS................................................................................. 173
16 -39.1003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  17  2..................................AMGTLEAQTQGPGSMQMNMVETEPVQGCRDFPPETMR-LRKYLFDVFHSTARKFGFEEYDSPVLESEELYRKAGEEITEQMFNFITKGGHRVALRPEMTPSLARQLLAKGRSLLLPAKWYSIPQCWRYEAITRGRRREHYQWNMDIIGVKSVSSEVECAACTAMQSLGLSSKDVG---------------------------KINSRKILQTVVEQAGVSADKFAPVCVIVDKMEKLPREEVVAQLAAIGL 228
17 -39.0004p71_C mol:protein length:338 Phenylalanine--tRNA ligase alpha subunit  ali model follow..  13  82.ALAARLAAERIDVTLPGRGQLSGGLHPVTRTLERIEQCFSRIG--YEVAEGPEVEDDYHNFEALNIPGHHPAR-----AMHDTFY-----------------------------------FNANMLLRTHTSPVQVRTMESQQ----PPIRIVCPGRVYRCD-SDLTHSPMFHQVEGLLVDEGVSFADLKGTIEEFLRAFFEKQLRFRPSFFPFTEPVCKQTGWLEVMGCGMVHPNVLRMSNIDPEGFAFGMGAERLAMLRYGVNDLRLFFDNDLRF....... 333
18 -38.3003od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  15  2...............................................NAMSKPFMFEKPFGMRDTLPEWYK-TKKNICDQMTEEINLWGYDMIETPTLEYYETVGVVSAILDQQLFKLLDQQGNTLVLRPDMTAPIARLVASSLKDRAYPLRLAYQSNVYRAQQNEGGKPAEFEQLGVELIGDGTASADGEALMIAALKRAGLSEFKVAIGHVGYVNAL.................................................................. 174
19 -38.1003bju_A mol:protein length:521 Lysyl-tRNA synthetase  ali model follow..  17  106......NKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLPHLHFGLKDKETRYRQRYLDLILNDFVRQIRSKIITYIRSFLDELGFLEIETPMMNII-----PGGAVAKPFITYHNELDMNLYMRIAPELYHKMLV------VGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADY--HDLMEITEKMVSGMVKH................................................................................. 296
20 -37.9005hgq_A mol:protein length:524 Lysine--tRNA ligase  ali model follow..  18  108......DRIKRGDIIGVNGYPARSKSGELSIIPYEIIQLTPCLPHTHFGLKNQETRYRMRYLDLIMNPDVKNTRSRMISFLRRYLDNLGFLEVETPMMNLI-----AGGATAKPFITHHNDLDMDLYLRVAPELYLKMLV------VGGIDRVYEIGRVFRNEGIDQTHNPEFTSCEFYMAYADY--EDLMKITEDMLARMVYSIPGLTERFELFVVTKEIVNAYTELNDPLTQRLRFDEQAKQKQPTAGWGMGIDRLAMILTDSNNIKEV.............. 502
21 -37.7001e1o_A mol:protein length:504 LYSYL-TRNA SYNTHETASE, HEAT INDUCIBLE  ali model follow..  17  113......KKWDLGDIIGARGTLFKTQTGELSIHCTELRLLTKALPDKFHGLQDQEVRYRQRYLDLIANDKSRQVRSKILAAIRQFMVARGFMEVETPMMQVI-----PGGASARPFITHHNALDLDMYLRIAPELYLKRLV------VGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADY--HDLIELTESLFRTL-AQEVLGTTKVTYGEHVFDFGKPFEKLTMREAIKKYRDEAMFYDEDYVGLGIGIDRMIMLFTNSHTIRDV.............. 494
22 -37.6001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  14  2...................................................YRLQIEKIRGFRDFYPEDMD-VEKFIFKTAEEAAEAFGFRRIDFPSLEYLDLYIKSGEELLQQTYSFVDKGGREVTLIPEATPSTVRMVTSR-KDLQRPLRWYSFPKVWRYEEPQAGRYREHYQFNADIFGSDSPEADAEALASSILDRLGLQYEIRINSRKIMEEIIGGMTSSDPFSFSIIDRYHKISREEFVDQLRSAGIGEDGVSMIADLCSGTRGI.............. 225
23 -37.5003a74_A mol:protein length:493 Lysyl-tRNA synthetase  ali model follow..  15  104......KISDLGDIVGVRGTMFKTKVGELSIKVSSYEFLTKALPEKYHGLKDIEQRYRQRYLDLIMNPESKKTRSLIIQSMRRYLDSHGYLEVETPMMHAV-----AGGAAARPFITHHNALDMTLYMRIAIELHLKRLI------VGGLEKVYEIGRVFRNEGISTRHNPEFTMLELYEAYADF--RDIMKLTENLIAHI-ATEVLGTTKIQYGEHLVDLTPEWRRLHMVDAIKEYVDEAHEMDEDFLGLGIGVDRLVMLLTNSPSIRDV.............. 484
24 -37.5005eln_A mol:protein length:535 Lysine--tRNA ligase  ali model follow..  17  116......SEIRRGDVVGFTGFPGKSKRGELSLFSKSVVLLSPCYPTAISGLKDQEVRYRQRYLDLMLNEESRKLRSRAIKYIRNYFDRLGFLEVETPMLNMI-----YGGAAARPFITYHNELETQLYMRIAPELYLKQLI------VGGLDKVYEIGKNFRNEGIDLTHNPEFTAMEFYMAYADY--YDLMDLTEELISGLVLEKPEMTERFELFVLGKELCNAYTELNEPLQQRKFFEQQADAKAPTGGWGLGIDRLIMFLADKNNIKEV.............. 507
25 -37.4001bbu_A mol:protein length:504 PROTEIN (LYSYL-TRNA SYNTHETASE)  ali model follow..  18  113......KKWDLGDILGAKGKLFKTKTGELSIHCTELRLLTKALPDKFHGLQDQEARYRQRYLDLISNDESRNVRSQILSGIRQFMVNRGFMEVETPMMQVI-----PGGAAARPFITHHNALDLDMYLRIAPELYLKRLV------VGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADY--KDLIELTESLFRTL-AQDILGKTEVTYGDVTLDFGKPFEKLTMREAIKKYRDEAMFYDEDYVGLGIGIDRMVMLFTNSHTIRDV.............. 494
26 -37.1004ex5_A mol:protein length:529 Lysine--tRNA ligase  ali model follow..  18  128......KKWDLGDIVAARGVLFRTNKGELSVKCTQLRLLAKALPDKFHGLADQETRYRQRYVDLIVTPETRTARTKAIASIRKFMGDADFMEVETPMLHPI-----PGGAAAKPFVTHHNALDMEMFLRIAPELYLKRLI------VGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDY--RWLMDFTERLIRQA-AVDALGTATIQYQGRELDLAQPFHRLTITQAIQKYAEEAMFFDADYIGCGIGIDRLVMLLTDSPTIRDV.............. 513
27 -37.0006aqh_A mol:protein length:508 Lysine--tRNA ligase  ali model follow..  17  111.....KTYVDIGDIVFVHGEVITSKRGELSVLADSWQMAAKALPVAHKEM-SEESRVRQRYVDLIVRDQARKQRIAVMRAIRSALERRGFLEVETPMLQTL-----AGGAAARPFVTHSNALDTELYLRIAPELFLKRCL------VGGFERVFELNRVFRNEGADSTHSPEFVMLETYQAYGTY--DDSAVVTRELIQEVADEAIGTRQVPLPDGTVYDLDGEWESIQ----MYPSLSEALGEEITPDTPAETLWAIAD......................... 353
28 -36.8005vl1_A mol:protein length:506 Lysine--tRNA ligase  ali model follow..  17  108.....KADVDIGDVVYVHGTVISSRRGELSVLADSWRMAAKALPVAHKEM-SEESRVRQRYVDLIVRPQAREQRIAVIRAVRNALERRGFLEVETPMLQTL-----AGGAAARPFVTHSNALDIDLYLRIAPELFLKRCI------VGGFDRVFELNRVFRNEGSDSTHSPEFSMLETYQTYGTY--DDSALITRELIQEVADEAIGTRQLSMPDGSVYDIDGEWATME----MYSSLSEALGEQITPETTVARLRDIAS......................... 350
29 -36.7002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  17  4...............................................YQDPMAKNIQAIRGMNDYLPGETA-IWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDEMYTFEDRNGDSLTLRPEGTAGCVRAGIEHGLLYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDIDAELITARWWRALGIS................................................................................. 165
30 -36.5004rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  19  1...................................................GPMTARAVRGTKDLFGKELR-MHQRIVATARKVLEAAGALELVTPIFEETQVFEKGVGAATDEMFTFQDRGGRSLTLRPEGTAAMVRYLEHGMKVWPQPVRLWMAGPMFRAERPQKGRYRQFHQVNYEALGSENPILDAEVLLYECLKELGLRRLKVKLSS......................................................................... 167
31 -36.1001qe0_A mol:protein length:420 Histidine--tRNA ligase  ali model follow..  17  1......................................................MIKIPRGTQDILPEDSK-KWRYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSTDEMYTFKDKGDRSITLRPEGTAAVVRSYIEHKGNPNQPIKLYYNGPMFRYERKQKGRYRQFNQFGVEAIGAENPSVDAEAMVMHIYQSFGLKHLKLVINS......................................................................... 165
32 -35.9006chd_A mol:protein length:597 Lysine--tRNA ligase  ali model follow..  16  174......NKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLPHLHFGLKDKETRYRQRYLDLILNDFVRQIRSKIITYIRSFLDELGFLEIETPMMNII-----PGGAVAKPFITYHNELDMNLYMRIAPELYHKMLV------VGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADY--HDLMEITEKMVSGMV-SKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAPTAGWGMGIDRVAMFLTDSNNIKEV.............. 567
33 -35.7003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  12  1.................................SNAMNGTRSAWGARAWEAVRGFADRPPGMQDGYPDFAKR-RRAVETRLLSFVEDAGYEPVTSGLFEYVDTLRARSPESSRDWIRLFDGGGDAVALRPEMTPSIARMAAPRVAAGRTPIRWCYCERVYRRTSWASGKAAESTQVGIERIGEEASVMDVLRLLHEASAAAGVRHHRIVVSHARLVPRL.................................................................. 195
34 -35.7005e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  15  2...................................................AMSSIVAIKGFNDVLPTQTA-AWRRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRAIGDATDIVEKEMYTFPESLTLRPEGTAGCVRALVEHNLLRGATPRVWYMGPMFRYEKPQKGRYRQFHQFGVETFGVATPDIDAEMLTARLWKRMGVDHMV.............................................................................. 164
35 -35.4004ycv_A mol:protein length:516 Lysine--tRNA ligase  ali model follow..  18  107......DKIRRGDIVGIVGFPGKSKKGELSIFPKETILLSACLHMMKYGLKDTEIRYRQRYLDLLINESSRHTRTKIINFLRNFLNERGFFEVETPMMNLI-----AGGANARPFITHHNDLDLDLYLRIATELPLKMLI------VGGIDKVYEIGKVFRNEGIDNTHNPEFTSCEFYWAYADY--NDLIKWSEDFFSQLVYTKPGLTERLEMFICGKEVLNAYTELNDPFKQKECFKLQQKDREPTGGLGLGIDRITMFLTNKNSIKDV.............. 498
36 -35.3003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  12  7..................................................NDKINFSTPSGFPEFLPSEKR-LELYLLDTIRRVYESYGFTPIETPAVERLEVLQAKGNQGDNEKDKSGDTGSEARALKFDQTVPLAAYIARHLNDLTFPFARYQMDVVFRGERAKDGRFRQFRQCDIDVVGREKLSAQMPAIITEIFEAVNIGDFVI----------------------------RINNRKVLTGFFQSLNISETQIKSCISIIDNLEKIGEAKVKLELEKEGI 231
37 -34.9004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  13  1..............................MAMGTLEAQTQGPGSMTEQKRKLEKLTGVKGMNDILPQDAG-LWEFFEATVKSLLRAYGYQNIRTPIVEHTPLFTRGIGEVTDIVEKEMYSFGENLTLRPENTAAVVRAAIEHNMLYDGPKRLWYIGPMFRHERPQRGRYRQFHQVGVEALGFAGPDADAEMMCQRLWEDLGLTGIKLEINS......................................................................... 188
38 -34.9004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  16  19.....EELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGP--DESKQKFVLKTPKGTRDYSPRQMA-VREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLT---NIKRYHIAKVYRRDNPARGRYREFYQCDFDIAGNFDPMAECLKIMCEILSSLQIGDFLVKVND......................................................................... 224
39 -34.6004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  18  6...............................................FELRRQFVLKTPKGTRDYSPRQMA-VREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLT---NIKRYHIAKVYRRDNPTRGRYREFYQCDFDIAGNFDPMAECLKIMCEILSSLQIGDFLVKVND......................................................................... 171
40 -33.4001z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  11  1........................................MRGSGSIEGRMEKINYLLPEESAEMTLNQVKS-LRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGKEKMFQFIKHEGQSITLRYDFTLPLVRLYSQIKD--STSARYSYFGKIFRKEKRHKGRSTENYQIGIELFGESADKSELESLALQVIEQLGLNKTVFEIGSAKFFQRLCQLADGSTELLTELLLKKDLSGLNAFIEKNNFSKELRGLLKEIFITNELSRL.............. 234
41 -32.9003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  17  2................................................GSSSSGLVPRGSHMSETAS-PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGPGHSQGMNLWLMTSPEYHMKRLL------VAGCGPVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPLSADKTQLREVALFTFGVEPNIGKEKPTFVYHFPASQASLAQISTEDHRVAERFEVYYKGIEL.. 259
42 -32.7004up7_A mol:protein length:777 LYSINE--TRNA LIGASE  ali model follow..  17  104......KMIYRGDICGFTGHPTRTKTGELSLIPISGMILSPCLPSMHYGLGDQETRFRKRYLDLIVNPESVKLRTKVVKAVRKYLDDKGFLEVETPILNTI-----PGGATARPFITHHNQLDIQMYMRIAPELYLKELV------VGGINRVYEIGRLFRNEGIDQTHNPEFTTCEFYMAYADY--NDIMKMTEELLGNMVKDITGGSTKLEIKDRLMDINNEEDIKMLEKFFKEP................................................ 327
43 -31.8003g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  17  15....................................................................PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPFETRFVGPGHSQGINLYLMTSPEYHMKRLL------AAGCGPVFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDMYMNEVDDLLQQVLDCQPAESLSYQQAFQRHLEIDPLSADKTQLREAALFTMGVEPHIGKEKPTFIYHFPASQASLAQISTEDHRVAERFEVYYKGIEL.. 246
44 -30.5006FTT Entity 1(prereleased)  ali follow..  12  4..........................................................PDGVADVLFEDAHK-QEVLRHQLTQQLITHGYQLVSPPMIEFTESLSGASEDLKRQTFKIIDQLTRLMGIRADITPQILRIDAHHGG--DGIARYCYAGDVIHTLPSGLFGSRTPLQLGAEIFGCESIAADIEDVLFSMINSLDMSAVL.............................................................................. 153
45 -30.5005m8h_A mol:protein length:388 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  12  4..........................................................PDGVADVLFEDAHK-QEVLRHQLTQQLITHGYQLVSPPMIEFTESLSGASEDLKRQTFKIIDQLTRLMGIRADITPQILRIDAHHGG--DGIARYCYAGDVIHTLPSGLFGSRTPLQLGAEIFGCESIAADIEDVLFSMINSLDMSAVL.............................................................................. 153
46 -27.7001usy_A mol:protein length:275 ATP PHOSPHORIBOSYLTRANSFERASE REGULATORY SUBUNIT  ali model follow..  16  6..........................................................................FEKVFSFYSKATKKGFSPFFVPALEKAEEPA---------GNFFLDRKGNLFSIREDFTKTVLNHRKRYSP--DSQIKVWYADFVYRYSG---SDLVAEYQLGLEKVPRNSLDDSLEEIIVESASEFFEGPVIVEIGHTGVYEDL.................................................................. 138
47 -27.2001efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model follow..  16  72..........KGLVRLRPEPNPRLATGRVEVELSALEVLAEAKTPPFEKEASEELRLKYRYLDLRRRRENLRLRHRVIKAIWDFLDREGFVQVETPFL-----TKSTPEGARDFLVPYRHEPGLFYALPQSPQLFKQMLM------VAGLDRYFQIARCFRDEDLRADRQPDFTQLDLEMSFVEV--EDVLELNERLMAHV.................................................................................... 261
48 -26.1004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  17  120......ANINKESIVDVEGVVRKVNQQDVELHVQKIYVISLAEPEEGRATVNQDTRLDNRVIDLRTSTAVFRLQSGICHLFRETLINKGFVEIQTPKIISAA-----SEGGANVFTVSYF--KNNAYLAQSPQLYKQMCI------CADFEKVFSIGPVFRAEDSNTRHLTEFVGLDIEMAFNY-HYHEVMEEIADTMVQIGVEYTMPDPRNPKQSNSYDMFMRGEEILSGAQRIHDPQLHHGIDLPHAGGGIGLERVTMLFLGLHNVRQT.............. 503
49 -25.9004wj3_M mol:protein length:599 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  15  64......DRVRSEFVVKITGKVRLRPSGSIEVLGYELEVLNQAETPPFYSDVGEETRLRYRFIDLRRPEAKLKLRARITSSIRRYLDDNGFLDVETPIL-----GRPTPEGARDYLVPSRTYPGHFFALPQSPQLFKQLLM------VAGFDRYYQIAKCFRDEDLRADRQPEFTQIDIETSFLDE--SDIIGITEKMVRQL.................................................................................... 260
50 -25.9004rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  15  75............EVRPEGNENPEIPTGQIEVNATELTVLGESLPFQLDEQAGEEARLKYRYLDLRREGNALRLRSKVNAAARSVLAEHDFVEIETPTL-----TRSTPEGARDFLVPARLQPGSFYALPQSPQLFKQLLM------VAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVEA--DDVIAISEQVLKAV-----------------WATIGYDLPLPLPRISYEEAMRRFGSDKPDLRFGIELVECTEYFKDTT................... 302
51 -25.6004o2d_A mol:protein length:620 Aspartate--tRNA ligase  ali model follow..  15  91............EVRPEGNENPEIPTGQIEVNATELTVLGESLPFQLDEQAGEEARLKYRYLDLRREGNALRLRSKVNAAARSVLAEHDFVEIETPTL-----TRSTPEGARDFLVPARLQPGSFYALPQSPQLFKQLLM------VAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVEA--DDVIAISEQVLKAV-----------------WATIGYDLPLPLPRISYEEAMRRFGSDKPDLRFGIELVECTEYFKDTT................... 318
52 -25.6005w25_A mol:protein length:616 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  14  79......HRLRAEFCVSVAGVVEEIATGEIEVNATSLTVLGECLPFQLDEPAGEELRLKYRYLDLRRDDAAIRLRSRVNAAARAVLARHDFVEIETPTI-----TRSTPEGARDFLVPARLHPGSFYALPQSPQLFKQLLM------VAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVDA--EDIIAISEEVLTEL-----------------WALIGYRIPTPIPRIGYAEAMRRFGTDKPDLRFGLELVECTDFFSDTT................... 321
53 -25.4003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein  ali model follow..  22  13....................................................................KAIDIQTKILDYMTKFFTDRGFKWLLPIMLSPITDPLWPDPAGEGIRPAEVDVYGVRMRLTHSMILHKQLAIAMGLE------KIFVLSPNIRLESRRKRHSYEFTQLDFEIEGAK--MKDVMRLIEELIYGL--EFYDREENGVWKNYDLILPYGYGEVSSGGEREWEYEKRAGKLKPSAGAGIGVERLVRFIVGAKHIAEV.............. 281
54 -25.4001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  15  113....KSATVQNLEIHITKIYTISETPEALPILLEDASRSEAEAEAAGLPVVNLDTRLDYRVIDLRTVTAIFRIQAGVCELFREYLATKKFTEVHTPKLLGAP-----SEGGSSVFE--VTYFKGKAYLAQSPQFNKQQLI------VADFERVYEIGPVFRAENSNTRHMTEFTGLDMEMAFEE-HYHEVLDTLSELFVFI---YTMPDPANPKYSNSYDFFMRGEEILSGAQRIHDHAKAHGLSPPHAGGGIGLERVVMFYLDLKNIRRA.............. 478
55 -25.4003ig2_A mol:protein length:213 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  17  1....................................................................SNADKSNKLQNLVAEQLVGCGFNEILNNSLTRAAYYDGLESYPSKNLVMLLNPLSADLCMRQTLLFGGLESIAHNANRKNADLKFFEFGNCYHFDAEKKNPEKEDYHLGLWVTGENTSVYELKAYVENIFKRLGLDLHSLVVGNL--TALTVNTKGGKRLATFGVVTKKMLKAFDVDNEVYYADLNWKELM.......................... 213
56 -25.3001eqr_A mol:protein length:590 ASPARTYL-TRNA SYNTHETASE  ali model follow..  15  61......SELRNEFCIQVTGTVRARATGEIEVLASSLTIINRALPLDSNHVNTEEARLKYRYLDLRRPEQRLKTRAKITSLVRRFMDDHGFLDIETPML-----TKATPEGARDYLVPSRVHKGKFYALPQSPQLFKQLLM------MSGFDRYYQIVKCFRDEDLRADRQPEFTQIDVETSFMTA--PQVREVMEALVRHL.................................................................................... 255
57 -25.1003ica_A mol:protein length:213 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  17  6.........................................................................RYKWQTVVSEQLVGAGFNEILNNSLTAGSYYEGLKSHPREMAVELMNPLSQELCMRQTLLFGGLETLSHNLRRKHLSLYLFEWGKCYRFHAAKRTDYAEDDRLGIWICGEPTSVFELKAVVEQVLCRVGIETGAYTLKTA--SAMEVKTRSGKLLGTFGTVSTELIKRFEIEQPVYFAELLWDALM.......................... 213
58 -25.1001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  21  16.......................................................................DIQTKILEYMTDFFVKEGFKWLLPVIISPITDPLWPDPAGEGMEPAEVEIYGVKMRLTHSMILHKQLAIAMGLK------KIFVLSPNIRLESRQKRHAYEFTQLDFEVERAK--MEDIMRLIERLVYGL-FEVFEYSEVLEEFGSDEEVASGGEREWEYEKIVAKIRKKAGKLKPSAGAGIGVERLVRFIVGAKHIAEV.............. 281
59 -24.9001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  17  64......KKLGRESSVIVEGIVKADEPGGAEVHVEKLEVIQAVSEPENPEQASPELLLDYRHLHIRTPKAIMKVKETLIMAAREWLLKDGWHEVFPPILVT-------GAVEGGATLFKLKYFDKYAYLSQSAQLYLEAAIFGLE-------KVWSLTPSFRAEKSRTRHLTEFWHLELEAAWMD--LWDIMKVEEELVSYMTLKNTEPPFPRISYDEAIDILQSYGEIIGGSQREDDYDLEEGMDPPHSGFGLGVERLVAWVLKLDHIRWA.............. 422
60 -24.8001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  14  49....GLKLPLPESALRVRGLVVENAKGGLEVQAKEVEVLSPALEPKEEWRANPDTLLEYRYVTLRGEKAPLKVQAALVRGFRRYLDRQDFTEIFTPKVVR-------AGAEGGSGLFGVDYFEKRAYLAQSPQLYKQIMVGVFE-------RVYEVAPVWRMEHHTSRHLNEYLSLDVEMGFIA-DEEDLMRLEEALLAEMSVRPFYTYPEEDGTTRSFDLLFRGLEITSGGQRIHRYEKAKGMDPEAFGFAIGAERLTQKLLGLPNVRYA.............. 410
61 -24.3001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  18  64......PKLRSEDVVAVEGVVNFTPKAKIVVLNRAETPLPLDPTGKVKAELDTRLNNRFMDLRRPEVMAIFKIRSSVFKAVRDFFHENGFIEIHTPKIIATA-----TEGGTELFPMKYF--EEDAFLAESPQLYKEIMM------ASGLDRVYEIAPIFRAEEHNTRHLNEAWSIDSEMAFIE-DEEEVMSFLERLVAHA---YIMKYDNKPEICRAFDLEYRGVEISSGGQREHRHDKEKGLNPPHGGFGLGAERLIKQMLDLPNIREV.............. 426
62 -24.1004ah6_A mol:protein length:617 ASPARTATE--TRNA LIGASE, MITOCHONDRIAL  ali model follow..  14  69......CEAPVESVVQVSGTVIKMPTGEIEIKVKTAELLNACKKLPFFVKKTEALRLQYRYLDLRSFQYNLRLRSQMVMKMREYLCNLGFVDIETPTL------FKRTPGGAKEFLVPSREPGKFYSLPQSPQQFKQLLM------VGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVDQ--TGIQSLIEGLLQYS.................................................................................... 265
63 -24.0001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  14  61......QELTQESVIQVRGIVKADKRAPITLLSKAKAPLPLDVSGKVKADIDTRLRERVLDLRRQEMQAVIKIQSLALKAFRETLYKEGFIEIFTPKIIASAT---EGGAQLFPVIYF----GKEAFLAQSPQLYKELMAGVVE-------RVFEVAPAWRAEESDTFHLAEFISMDVEMAFAD--YNDVMQLLEKILHNI---YTKSKSENPELSESFDLIYKFLEIVSGSTRNHKREKKKGLKPESFGFGMGLARLMVMLTGIQSVKEI.............. 417
64 -23.3003cmq_A mol:protein length:415 Phenylalanyl-tRNA synthetase, mitochondrial  ali model follow..  13  1................................MAAECATQRAPGSVVELLGKSYPQDDHSNLTRKLHNQQHHPLWLIKERVKEHFYKQYVGRFGTPLFSVYDNLSPVVTTWQNPADHPSRKKGDNYYLNRTHMLRAHTSAHQWDLLHAGLDAFLVVGDVYRRDQIDSQHYPIFHQLEAVRLAVKLVEFDLKQTLTRLMAHLFGDELEIVDCYFPFTHPINFHGEWLEVLGCGVMEQQLVNSAGAQDRIWAFGLGLERLAMILYDIPDIRLFWCEDERF....... 303
65 -23.1004h2w_A mol:protein length:346 Amino acid--[acyl-carrier-protein] ligase 1  ali model follow..  16  1.............MGSSSSGLVPRGSHMNIAVLPNSPDTAPQIADPLDHLADKLFHSMGSDGVYARTALYESIVERLAALITS-HREAGTEALRFPPVMSRAQLEKSGSRFDAGGDWTTSLSPADLVLSPAACYPVYPIAASRGPLPKGGLRFDVAADCFRRESKHLDRLQSFRMREYVCIGTPDDVERWMVRAQAIARDLGLTFRVDYASDPFFGRALRSEEQPTACMSFNYHREHFGTTWGIQDATGCVAFGMDRLAVAMFHTHGTDL............... 313
66 -23.0003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  16  77......KLLTRECSLEITGRLNAYAILNLEMQVTEWKVIGESLENIINKDSSIPQKMQNRHIVIRSEHQVLQLRSEIQWYFRKYYHDNHFTEIQPPTIVKTQ-----CEGGSTLFKLQYF--NEPAYLTQSSQLYLESVIASLG-------KSFCMLSSYRAEQSRTRHLAEYLHLEAELPFIS--FEDLLNHLEDLVCTV-IDNVMAVHGDKIYADAIKYCND--EIVGGSMRIWNYDKANGLNPPHGGYGLGVERLVMWLLGEDHIRKV.............. 444
67 -22.7005xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  19  83CQCYNGVLLSTESSVAVYGMLNLTPKGKHELSCDFWELIGLAPAGGADNLIDVQLNNRHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQ-----VEGGATLFKLDYF--GEEAFLTQSSQLYLETCLPALG-------DVFCIAQSYRAEQSRTRHLAEYTHVEAECPFLT--FDDLLNRLEDLVCDVAIVWLKEHDVKKEDGTFYEIVGGSMRIFDSEEILAGYKRE-GIDPPHGGYGLGLERFLTWILNRYHIRDV.............. 454
68 -22.6002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  15  53CQTYDALTVNTECTVEIYGAIKEVPEGKEAPNGHELIADFWKIDNVLNEEASVDKMLDNRHLVIRGENALLRLRAAATRAMREHFYNAGYVEVAPPTLVQTQ-----VEGGSTLFNLDYF--GEQSFLTQSSQLYLETCIPTLG-------DVFCIAQSYRAESRTRRHLAEYAHVEAECPFIT--LDDLMEKIEELVCDTAIKWLQEHNVENEFGNTFEIVGGSMRIWKFDELSKAFKNV-EIDPPHGGYGLGLERFICWLTNTNHIRDV.............. 425
69 -22.4003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  16  181.........VDEKIAKFLKDNEGKDLTKRPLKDEYAKLLKEKASAQKYVKVSQDTRLDNRMLDLRTVIAIFRIQSACCGLFREFLTSQKFVEIHTPKLIGCS-----SEGGSNIFEVKYF--DRKAYLAQSPQLYKQMAI------MGDFRKVFEVGPVFRAENSNTRHLTEFEGLDIEMEIVE-NYHECIDVMEKLFTFIAIEYTMPDIDDPNYSNSYDVFVRGQEITSGAQRIHDPEIEKGVDPPHAGCGIGLERITMLYLGIPNIRKV.............. 536
70 -22.4003mey_A mol:protein length:346 Bll0957 protein  ali model follow..  15  1.............MGSSSSGLVPRGSHMNIAVLPNSPDTAPQIADPLDHLADKLFHSMGSDGVYARTALYESIVERLAALITS-HREAGTEALRFPPVMSRAQLEKSGSRFDAGGDWTTSLSPADLVLSPAACYPVYPIAASRGPLPKGGLRFDVAADCFRRESKHLDRLQSFRMREYVCIGTPDDVSDWMVRAQAIARDLGLTFRVDYASDPFFGRVLRSEEQPTACMSFNYHREHFGTTWGIQDATGCVAFGMDRLAVAMFHTHGTDL............... 313
71 -20.0003l4g_B mol:protein length:589 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  13  352......................PPTRADIIHACDIVEDAAIAYG--YNNIQMTLPKTYTIA--------NQFPLNKLTELLRHDMAAAGFTEALTFALCSQEDIADKLDISATKAVHISNPKTAEFVARTTLLPGLLKTIAANRKM-PLPLKLFEISDIVIKDSNTDVGAKNYRHLCAVYYNKNPGFEIIHGLLDRIMQLLDVPPGEDKGGYVI-GRCAEIFARGQSVGKLGVLHPDVITKFELTMPCSSLEINIGPFL.......................... 589
72 -18.9002i4l_A mol:protein length:458 Proline-tRNA ligase  ali model follow..  13  2.............GSSSSGLVPRGSHMRLSRFFLPIENPKEAEIVSHRLMLRAGMLRQEAAGIYAWLPLGHRVLKKIEQIVREEQNRAGAIELLMPTLQLADLWRESGDAYGPEMLRIADRHKRELLYGPTNEEMITEIFRAYIKSYKSPLNLYHIQWKFRDEQRPRFRGREFLMKDAYSFDVDEAGARMFVAYLRTFARMGLKAIPMRAET......................................................................... 213
73 -18.2004lns_A mol:protein length:351 Asparagine synthetase a  ali model follow..  12  11....................................................................LLQEQILTVKRSFSEALEKENLVEVRAPILFRVGDGTQDNLSGFEKAVQVPVKAIPNASFEVVHSLAKWKRRTLANYKFAPGHGLYTHMTALRVDVLDNIHSVVVDQWDWEMVDDQRNLAFLKEVVCKVYAAIGAVFLIGIGAVLSSGDRHPTLDDSLEVSSMGVNAEALRHQISLTGQTVGGGIGQSRMVMFMLRKKHIGEVQCSVWPEEIRKKH. 348
74 -17.9002cim_A mol:protein length:522 SERYL-TRNA SYNTHETASE  ali model follow..  15  219................................................................IHGPQSARIFRTFEKIVLEELEPLGYREMIFPKLVTWEVWMKSGTHEVPTKLIKEKIAEPIGGMCYAQCPPFWMYVAGETLPNEEPVKVFDRGTSHRYESGGIHRVDEFHRIEIVWIGTKEEVLKLHDRYMHIFNDILDIEWRKARVTPWFMAQEGLLGEWLEFQNVSINGDKYPKGFNVKLQ---SGVGLERWAAVFLA..................... 489
75 -17.3004k86_A mol:protein length:535 Proline--tRNA ligase  ali model follow..  19  1MGSSSSGLVPRGSHMASGAGEGQGPKKQTRLGLEAKKEENLADWYSQVITKSEMIEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKVADFAPEVAWVTRLAEPIAIRPTSETVMYPAYAKWVQSHRDPIKLNQWCNVVRWEFKHPQRTREFLWQEGHSAEAAEEVLQILDLYAQVYEELLAIPVVKGRKT......................................................................... 228

FFAS is supported by the NIH grant R01-GM087218-01
1 2 5 9 6 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24