current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 2zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300
# Score Template Links and tools%idFirst MGSSSSGLVPRGSHMFLTRRDPPLSSFWTKVQYQRLKELNASGEQLEMGFSDALSRDRAFQGIEHQLMSQGKRHLEQLRTVKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEDHPLFSQVFWLDGKKCLRPMLAPNLYTLWRELERLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAAGIREFELVTESSVVYGDTVDVMKGDLELASGAMGPHFLDEKWEIFDPWVGLGFGLERLLMIREGTQHVQSMARSLSYLDGVRLNINLast
1 -145.0002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model  100  1MGSSSSGLVPRGSHMFLTRRDPPLSSFWTKVQYQRLKELNASGEQLEMGFSDALSRDRAFQGIEHQLMSQGKRHLEQLRTVKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEDHPLFSQVFWLDGKKCLRPMLAPNLYTLWRELERLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAAGIREFELVTESSVVYGDTVDVMKGDLELASGAMGPHFLDEKWEIFDPWVGLGFGLERLLMIREGTQHVQSMARSLSYLDGVRLNIN 302
2 -82.2004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  40  2.........................PALTKSQTDRLEVLLNPKD------EISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLANYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRE--NLESIITDFLNHLGI-DFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL. 268
3 -81.2003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  38  5..............LVPRGSHGASAPALTKSQTDRLEVLLNPKD------EISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLTPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLVFWQMGSGCT--RENLESIITDFLNHLGI-DFKIVGDSCMVFGDTLDVMHGDLELSSALVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL. 282
4 -79.7004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  39  1MGS-------SSSGLVPRGSHMASAPALTKSQTDRLEVLLNPKD------EISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLGNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCT--RENLESIITDFLNHLGI-DFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPRPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL. 285
5 -79.7004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  40  2..........................ALTKSQTDRLEVLLNPKD------EISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMVAPNIFNYARKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFFQMGSGCT--RENLESIITDFLNHLGI-DFKIVGDSCSVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL. 267
6 -77.7004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  39  4..........SSSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEI------SLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLSFIQMGSGCT--RENLESIITDFLNHLGI-DFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL. 285
7 -77.6002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  39  4..........SSSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEI------SLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCT--RENLESIITDFLNHLGI-DFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSGSYYNGISTNL. 285
8 -54.5001nyq_A mol:protein length:645 threonyl-tRNA synthetase 1  ali model follow..  16  174..QGDFTDLCRGVHVPSTAKIKEFKLL-NNKMLQRIYGTAFELKAHLQMLEERKERDHRKIGKELELFTNSQLVGAGLPLWLPNGATIRIERYIVDKEVSMGYDHVYTPVLANVDLY-KTSGHWDHYQEDMFPPMTESMVLRPMNCPHHMMIYANKPHSYELPIRIAELGTMHRYEASGAVSVRGMTLNDSHIFVRPDQEEFKRVVNMIIDVYKDFGFEDYSFRLSYRDP---------------EDKEKYFDDDDMWNKAENML-------KEAADELGLSYEEAIGEAAFYGPKLDVQVK 477
9 -46.6001qf6_A mol:protein length:642 THREONYL-TRNA SYNTHETASE  ali model follow..  14  175..HEEYVDMCRGPHVPNMRFCHHFKLM-NNKMLQRIYGTAWALNAYLQRLEEAAKRDHRKIGKQLDLYHMQEE-APGMVFWHNDGWTIELEVFVRSKLKEYQYQEVKGPFMMDRVLWEK-TGHWDNYKDAMFTTSNREYCIKPMNCPGHVQIFNQGLKSYDLPLRMAEFGSCHRNEPSGSLHVRGFTQDDAHIFCTEEQDEVNGCIRLVYDMYSTFGFEKIVV-------------------KLSTRPEKRIGSDEMWDRAEADL-------AVALEENNIPFEYQLGEGAFYGPKIEFTLY 471
10 -38.9003a31_A mol:protein length:471 Probable threonyl-tRNA synthetase 1  ali model follow..  13  8.........................................THIDYAYELDITVKPDSRVPVFNREFATF---TGAGVPLFSLGGGPIRLAEVLAKFHARRGYYVVETPIIASTELF-KVSGHIEFYRNNMYLFDGHEFAVKPMNCPYHILLFLNEVAKHPLPFKVFEFGRVHRYEPSGSIYVRGFTQDDAHIIVPGGRVIDVEEMKLVLERLFKLGVETFKVRLSMSDK--------------SLIGKEFMGSKEEWEGAEEALREA---ASRINEKYGIDIVELEGEAAFYGPKLDFIM. 265
11 -37.0004hwo_A mol:protein length:411 Threonine--tRNA ligase  ali model follow..  15  2......................................................ARDHRKIGKQLDLYHMQEE-APGMVFWHNDGWTIELEVFVRSKLKEYQYQEVKGPFMMDRVLWEK-TGHWDNYKDAMFTTSNREYCIKPMNCPGHVQIFNQGLKSYDLPLRMAEFGSCHRNEPSGSLHVRGFTQDDAHIFCTEEQDEVNGCIRLVYDMYSTFGFEKIVV-------------------KLSTRPEKRIGSDEMWDRAEADL-------AVALEENNIPFEYQLGEGAFYGPKIEFTLY 232
12 -37.0004p3n_A mol:protein length:415 Threonine--tRNA ligase, cytoplasmic  ali model follow..  17  1.................................................MGSSSSGDHRKIGRDQELYFFHELS-PGSCFFLPKGAYIALIEFIRSEYRKRGFQEVVTPNIFNSRLWMT-SGHWQHYSENMFSFEKELFALKPMNCPGHCLMFDHRPRSWELPLRLADFGVLHRNELSGATRVRRFQQDDAHIFCAMEQDEIKGCLDFLRTVYSVFGFS--------------------FKLNLSTRPEKFLGDIEVWDQAEKQL-------ENSLNEFGEKWELNSGDGAFYGPKIDIQIK 235
13 -36.7003ugq_A mol:protein length:460 Threonyl-tRNA synthetase, mitochondrial  ali model follow..  13  5............................SSGLVPRGSHMASATKN---ASSATPATMTSMVSQRQDLFMTDPLS-PGSMFFLPNGAKIKLIEFMKLQQKKFGFNEVVTPLIYKKTLWEK-SGHWENYADDMFKVEKEEYGLKPMNCPGHCLIFGKKDRSYELPLRFSDFSPLHRNEASGATRLRKFHQDDGHIFCTPSQSEIFNSLKLIDIVYNKIPFVKGGSGAESN-----------YFINFSTRPDHFIGDLKVWNHAEQVL-------KEILEESGKPWKLNPGDGAFYGPKLDIMVT 271
14 -35.2004hwt_A mol:protein length:413 Threonine--tRNA ligase, cytoplasmic  ali model follow..  17  2......................................................ARDHRKIGRDQELYFFHELS-PGSCFFLPKGAYIALIEFIRSEYRKRGFQEVVTPNIFNSRLWMT-SGHWQHYSENMFSFEKELFALKPMNCPGHCLMFDHRPRSWELPLRLADFGVLHRNELSGATRVRRFQQDDAHIFCAMEQDEIKGCLDFLRTVYSVFGFS--------------------FKLNLSTRPEKFLGDIEVWDQAEKQL-------ENSLNEFGEKWELNSGDGAFYGPKIDIQIK 231
15 -33.1001z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subu  ali model follow..  13  2......................................................RGSGSIEGRMEKINYLLPEESAEMTLNQVK-SLRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGQEKMFQFIKHEGQSITLRYDFTLPLVRLYSQIKD--STSARYSYFGKIFRKEKRHKGRSTENYQIGIELFGESADKSELEILSLALQVIEQLGLNKTVFEIGSAKFFQRLCQLADGSTELLTELLLKKDLSGLNAFIEK....................................... 211
16 -29.4001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  16  26.........................................................................................IFKTAEEAAEAFGFRRIDFPSLEYLDLYRIKSGEELQQTYSFVDKGGREVTLIPEATPSTVRMVTSR-KDLQRPLRWYSFPKVWRYEEPQAGRYREHYQFNADIFGSDSPEADAEVIALASSILDRLGLQDYEIRINSRKIMEEIIG.................................................................. 173
17 -28.8003od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subu  ali model follow..  14  26.....................................................................................TKKNICDQMTEEINLWGYDMIETPTLEYYETVGVVSAILDQQLFKLLDQQGNTLVLRPDMTAPIARLVASSLKDRAYPLRLAYQSNVYRAQQNEGGKPAEFEQLGVELIGDGTASADGEVIALMIAALKRAGLSEFKVAIGHVGYVNALLMDVVGNEQRADRLRRFLYEKNYVGYREHVKSLNLSRLMNLLSLRGGRAAIEEARGLIQTEKGKTALA 247
18 -27.7003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  13  39.....................................................................................RRRAVETRLLSFVEDAGYEPVTSGLFEYVDTLLRRSPESSRDWIRLFDGGGDAVALRPEMTPSIARMAAPRVAAGRTPIRWCYCERVYRRTDDPSGKAAESTQVGIERIGEEASDVDMDVLRLLHEASAAAGVRHHRIVVSHARLVPRLLDALGISASLSRAFLACLTSGNYVQFRE........................................ 223
19 -25.5001usy_A mol:protein length:275 ATP PHOSPHORIBOSYLTRANSFERASE REGULATORY SUBU  ali model follow..  12  6.......................................................................................FEKVFSFYSKATKKGFSPFFVPALEKAEEPA---------GNFFLDRKGNLFSIREDFTKTVLNHRKRYSP--DSQIKVWYADFVYRYSG---SDLVAEYQLGLEKVPRNSLDDSLEVLEIIVESASEFFEGPVIVEIGHTGVYEDLLKEIPKDLH........................................................... 147
20 -25.3003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  15  1.................................................MAMGTLEAQTQGPGSMQKNMVETEPVQGCRDFPPEAMRCRLFDVFHATAKTFGFEEYDAPVLESEELYRKAGEEITEQMFNFITKGGHRVALRPEMTPSLARLLLGKGRSLLLPAKWYSIPQCWRYEAITRGRRREHYQWNMDIVGVKSVSAEVELVCAACWAMRSLGLKDVGIKVNSRKVLQTVVEQ................................................................. 193
21 -25.2003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  14  1.................................................MAMGTLEAQTQGPGSMQMNMVETEPVQGCRDFPPETMRLRLFDVFHSTARKFGFEEYDSPVLESEELYRKAGEEITEQMFNFITKGGHRVALRPEMTPSLARQLLAKGRSLLLPAKWYSIPQCWRYEAITRGRRREHYQWNMDIIGVKSVSSEVELVCAACTAMQSLGLKDVGVKINSRKILQTVVEQ................................................................. 193
22 -24.7001qe0_A mol:protein length:420 HISTIDYL-TRNA SYNTHETASE  ali model follow..  15  22.........................................................................................IENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSTDVVQKEMYTFDRSITLRPEGTAAVVRSYIEMQGNPNQPIKLYYNGPMFRYERKQKGRYRQFNQFGVEAIGAENPSVDAEVLAMVMHIYQSFGLKHLKLVINS........................................................................... 165
23 -24.5004rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  14  25.........................................................................................IVATARKVLEAAGALELVTPIFEETQVFEKGVGAATDIVRKEMFTFGRSLTLRPEGTAAMVRAYEHGMKVWPQPVRLWMAGPMFRAERPQKGRYRQFHQVNYEALGSENPILDAEAVVLLYECLKELGLRRLKVKLSSERLELNPMRILDSKSERDQALLKELGVRPMLDFLGEEARAHLKEVERHLERLSVPYELEPARGLDYYVRTAFEV. 273
24 -23.8003bju_A mol:protein length:521 Lysyl-tRNA synthetase  ali model follow..  17  122................................KTKKGELSIIPYEITLLSPCLHMLPHLHFGLKDKETRYRQRYLDLILNDFVRQKFIKIITYIRSFLDELGFLEIETPMMNIIP-----GGAVAKPFITYHNELDMNLYMR--IAPELYHKMLVVGGID----RVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHI-TGSYKVTYHPDGPEGQAYDVD................................................................ 318
25 -23.7004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  18  46.........................................................................................FEATVKSLLRAYGYQNIRTPIVEHTPLFTRGIGEVTDIVEKEMYSFGENLTLRPENTAAVVRAAIEHNMLYDGPKRLWYIGPMFRHERPQRGRYRQFHQVGVEALGFAGPDADAEIVMMCQRLWEDLGLTGIKLEINS........................................................................... 188
26 -23.4001e1o_A mol:protein length:504 LYSYL-TRNA SYNTHETASE, HEAT INDUCIBLE  ali model follow..  19  103LPEGVYNDQFKGDIIGARGTL-----------KTQTGELSIHCTELRLLTKALRPLPDKFHGLQDQEVRYRQRYLDLIANDKSRQTFVKILAAIRQFMVARGFMEVETPMMQVIP-----GGASARPFITHHNALDLDMYLR--IAPELYLKRLVVGGFE----RVFEINRNFRNEGISVRHNPEFTMMELYMAYADYHDLIELTESLFRTLAQEV...................................................................................... 304
27 -23.4001bbu_A mol:protein length:504 PROTEIN (LYSYL-TRNA SYNTHETASE)  ali model follow..  18  103LPEGVYNEQFKGDILGAKGKL-----------KTKTGELSIHCTELRLLTKALRPLPDKFHGLQDQEARYRQRYLDLISNDESRNTFKQILSGIRQFMVNRGFMEVETPMMQVIP-----GGAAARPFITHHNALDLDMYLR--IAPELYLKRLVVGGFE----RVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESLFRTLAQDI...................................................................................... 304
28 -23.3004up7_A mol:protein length:777 LYSINE--TRNA LIGASE  ali model follow..  19  120................................RTKTGELSLIPISGMILSPCLHMLPSMHYGLGDQETRFRKRYLDLIVNPESVKNFVKVVKAVRKYLDDKGFLEVETPILNTIP-----GGATARPFITHHNQLDIQMYMR--IAPELYLKELVVGGIN----RVYEIGRLFRNEGIDQTHNPEFTTCEFYMAYADYNDIMKMTEELLGNMVKDI...................................................................................... 295
29 -23.3003a74_A mol:protein length:493 Lysyl-tRNA synthetase  ali model follow..  18  120................................KTKVGELSIKVSSYEFLTKALRPLPEKYHGLKDIEQRYRQRYLDLIMNPESKKTFILIIQSMRRYLDSHGYLEVETPMMHAV-----AGGAAARPFITHHNALDMTLYMR--IAIELHLKRLIVGGLE----KVYEIGRVFRNEGISTRHNPEFTMLELYEAYADFRDIMKLTENLIAHIATEV...................................................................................... 295
30 -22.5004ex5_A mol:protein length:529 Lysine--tRNA ligase  ali model follow..  22  144................................RTNKGELSVKCTQLRLLAKALRPLPDKFHGLADQETRYRQRYVDLIVTPETRTTFRKAIASIRKFMGDADFMEVETPMLHPIP-----GGAAAKPFVTHHNALDMEMFLR--IAPELYLKRLIVGGFE----RVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRWLMDFTERLIRQAAVDA...................................................................................... 319
31 -22.1005e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  15  26.........................................................................................LEQHLASLMDAYGYQQIRLPIVEQTGLFKRAIGDATDIVEKEMYTFFDKLTLRPEGTAGCVRALVEHNLLRGATPRVWYMGPMFRYEKPQKGRYRQFHQFGVETFGVATPDIDAELIMLTARLWKRMGVDHM................................................................................. 163
32 -21.9002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  17  32.........................................................................................IEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFGDSLTLRPEGTAGCVRAGIEHGLLYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDIDAELIMLTARWWRALGISE.................................................................................. 166
33 -21.7004ycv_A mol:protein length:516 Lysine--tRNA ligase  ali model follow..  16  123................................KSKKGELSIFPKETILLSACLHMLPMKY-GLKDTEIRYRQRYLDLLINESSRHTFVKIINFLRNFLNERGFFEVETPMMNLI-----AGGANARPFITHHNDLDLDLYLR--IATELPLKMLIVGGID----KVYEIGKVFRNEGIDNTHNPEFTSCEFYWAYADYNDLIKWSEDFFSQLVYHL-FGTYKISYNKDGPENQPIEID................................................................ 318
34 -21.7003g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  14  21.......................................................................................AAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPFETRFVGPGHSQGINLYLM--TSPEYHMKRLLAAGC-----PVFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCQPAESLSYQQAFQRHLEDPLSADKTQLREAAAKLDTMGVEPHIGKEKPTFIYHFPASQASLAQISTEDHRVAERFEVYYKGIEL... 246
35 -21.4003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  13  34.......................................................................................AAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGPGHSQGMNLWLM--TSPEYHMKRLLVAGC-----PVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEDPLSADKTQLREVAAKLDTFGVEPNIGKEKPTFVYHFPASQASLAQISTEDHRVAERFEVYYKGIEL... 259
36 -19.1003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  12  31........................................................................................YLLDTIRRVYESYGFTPIETPAVERLEVLQAKGNQGDNIIYGLEPILPEARALKFDQTVPLAAYIARHLNDLTFPFARYQMDVVFRGERAKDGRFRQFRQCDIDVVGREKLSYDAQMPAIITEIFEAVNIGDFVIRINNRKVFFQSLNISETQIKSCISIIDNLEKIGEAKVKLELEKEGINPEQTQKI---IDFVKIDGSVDDVLDKLK.... 257
37 -18.4003mey_A mol:protein length:346 Bll0957 protein  ali model follow..  16  59....................................................................................SIVERLAALITS-HREAGTEALRFPPVMSRAQLEKSGSRFDAGGDWTTSLSPADLVLSPAACYPVYPIAASRGPLPKGGLRFDVAADCFRREPSHLDRLQSFRMREYVCIGTPDDDFRERWMVRAQAIARDLGLTVSQKQQQLKFELLIPLRSEEQPTACMSFNYHREHFGTTWGIQDA---VAFGMDRLAFHTHGTD.................... 312
38 -18.1004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  13  1...........GPGSEFELRRQMAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQ-KGTRDYSPRQMAVRVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLT---NIKRYHIAKVYRRDNPTRGRYREFYQCDFDIAGNFDP-PDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICVSDSKFRTICSSVDKLDKSWEEVKNEMVGEKGLAPEVADRIG-DYVQQHGG............. 287
39 -18.0004h2w_A mol:protein length:346 Amino acid--[acyl-carrier-protein] ligase 1  ali model follow..  17  54...................................................................................TALYESIVERLAALITSHGTEALRFPPVMSRAQLEKSGSRFDAGGDWTTSLSPADLVLSPAACYPVYPIAASRGPLPKGGLRFDVAADCFRREPSHLDRLQSFRMREYVCIGTPDDDFRERWMVRAQAIARDLGLTNNQRDQQLKFELLIPLRSEEQPTACMSFNYHREHFGTTWGIQDA---VAFGMDRLAFHTHGTD.................... 312
40 -17.7004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  14  33........................................................................................KVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLT---NIKRYHIAKVYRRDNPTRGRYREFYQCDFDIAGNFDP-PDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICVSDSKFRTICSSVDKLDKSWEEVKNEMVGEKGLAPEVADRIG-DYVQQHGG............. 234
41 -17.4002cim_A mol:protein length:522 SERYL-TRNA SYNTHETASE  ali model follow..  10  119VPADHELRMLKVPYIKSMENIEGGIQL-KNRVPDRILTLLEEKAEHWNLLWQREPMEHPFKEMKEGWLKRGSSRGQWIHGPQSARIFRTFEKIVLELLEPLGYREMIFPKLVTWEVWMKSGTHEVPTKLIKEKIAEPIGGMCYAQCPPFWMYVAGETLPNEIPVKVFDRGTSHRYESGGIERVDEFHRIEIVWIGTKEEKCAEELHDRYMHIFNDILDIEWRKARVTPWFMAQEGLLGLAEENTVGT-----------------TDYEACLPYRGPDGEWLEFQNVSINGDKYPKGFNVKLQ 466
42 -17.2003ig2_A mol:protein length:213 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  14  1.................................................................................SNADKSNKLQNLVAEQLVGCGFNEILNNSLTRAAYYDGLESYPSKNLVMLLNPLSADLCMRQTLLFGGLESIAHNANRKNADLKFFEFGNCYHFDAEKKNPYSEDYHLGLWVTGKMVSNSVYELKAYVENIFKRLGLDLHSLVVGNLSD-TALTVNTKGGKRLATFGVVTKKMLKAFDVDNEVYYADLNWKELM........................... 213
43 -16.2003ica_A mol:protein length:213 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  14  1.................................................................................SNADRRYKWQTVVSEQLVGAGFNEILNNSLTAGSYYEGLKSHPREMAVELMNPLSQELCMRQTLLFGGLETLSHNLRRKHLSLYLFEWGKCYRFHAAKRTDYAEDDRLGIWICGQRVHNSVFELKAVVEQVLCRVGIETGAYTLKTADN-SAMEVKTRSGKLLGTFGTVSTELIKRFEIEQPVYFAELLWDALM........................... 213
44 -15.8004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  19  131..........EGVVRKVNQKIGSCTQQDVELHVQKIYVISLAEPRLPLQLDDAVRPEAEGEEEGRATVNQDTRLDNRVIDTSTSQAVFRLQSGIRETLINKGFVEIQTPKIIS-------AASEGGANVFTVSYFKNNAYLAQ--SPQLYKQMCICADF-----KVFSIGPVFRAEDSNTRHLTEFVGLDIEMAFNYHYHEVMEEIA-ALAMLREAGVE-YTMPDPRNPKQSNSYDMFMRGEEILSGAQRIHDPQLLTERALPHAGGGIGLERVTMLFLGLHNVRQT............... 503
45 -15.8002du3_A mol:protein length:534 O-phosphoseryl-tRNA synthetase  ali model follow..  17  1......................................MKFDPQKYRELAEKDFEAAWKAGKEILAERSPNELYPRVGFSFGKEHPLFATIQRLREAYLSIGFSEVVNPLIVEDVHVKKQFGREALAVLDRCFYISSTLTLRSHMTTGWFITLSHIADKLPLPIKLFSIDRCFRREQGDATRLYTYFSASCVLV--DEELSVDDGKAVAEALLRQFGFENFRFRKDEK--YIPDTQTEVF-IEIATFGIYSPTALAEYDIPYPVMNLGLGVERLAMILYGYDDVRK-----MVYPQIHGEIK 356
46 -15.8001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  18  102..........RGIVKKVDEPIKSATVQNLEIHITKIYTISETPEALPILLEDASRSEAEAEAAGLPVVNLDTRLDYRVIDTVTNQAIFRIQAGVREYLATKKFTEVHTPKLLG-------APSEGGSSVFEVTYFKGKAYLAQ--SPQFNKQQLIVADFE----RVYEIGPVFRAENSNTRHMTEFTGLDMEMAFEEHYHEVLDTLS-GIEMLRAAGKE-YTMPDPANPKYSNSYDFFMRGEEILSGAMKAHGLSPEDPGLKDYCGGGIGLERVVMFYLDLKNIRRA............... 478
47 -15.7002du7_A mol:protein length:549 O-phosphoseryl-tRNA synthetase  ali model follow..  17  6.................................KRDDKMRFDIKKVLELAEKDFETAWRETRALIKDKHIDNKYPRLKPVYGKPHPVMETIERLRQAYLRMGFEEMINPVIVDEMEIYKQFGPEAMAVLDRCFYLATTLTLRSHMTSGWFITLSSLIKKRKLPLKLFSIDRCFRREQEDRSHLMSYHSASCVVV--GEDVSVDDGKVVAEGLLAQFGFTKFKFKPDEKSKYYTPTEVYAYHIEVATFGVYSPIALAKYNIDVPVMNLGLGVERLAMIIYGYEDVRAMVYPQFYEYRLS.... 361
48 -15.6003l4g_A mol:protein length:508 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  14  160..........RKRKLLAEVTLKTYWVSKGSAFSTSISKQETELSPEMISSGSWRDRPFKPYNFLAH------------PDSGHLHPLLKVRSQFRQIFLEMGFTEMPTDNFIESDALFQPQQHPARDQHDTFFLRDRKNLLRTHTTSSARALYRLAQKKPFTPVKYFSIDRVFRNETLDATHLAEFHQIEGVVA--DHGLTLGHLMGVLREFFTKLGITQLRFKPAYNPYTEPSMEVFSYHVEVGNSGVFRPEMLLPMGLPESVIAWGLSLERPTMIKYGINNIRE-----LVGHKVNL... 484
49 -15.4001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  15  62.......ELTQESVIQVRGIVKADKRAPRGIELEEITLLSKAKAPLPLDVSGKVKADIDTR-LRERVLDLRRQEMQAVIKIQS-----LALKAFRETLYKEGFIEIFTPKIIASATEGGAQLFPVIYFGKEAFLAQSPQLYKELMAGVV---------------RVFEVAPAWRAEESDTFHLAEFISMDVEMAFADYNDVMQLLEKILHNIVKTIKEE-YTKSKSENPELSESFDLIYKFLEIVSGSTRNHKREVLEEALKPHAGFGMGLARLMVMLTGIQSVKEI............... 417
50 -15.2001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  17  64......PKLRSEDVVAVEGVVNFTPKAKLGFEIEKIVVLNRAETPLPLDPTGKVKLDTRLNNRFMDLRRPEVMAIFKIRS--------SVFKAVRDFFHENGFIEIHTPKIIA-------TATEGGTELFPMKYFEEDAFLAE--SPQLYKEIMMASGLD----RVYEIAPIFRAEEHNTRHLNEAWSIDSEMAFIEDEEEVMSFLE-ALEILGDLGKE-YIMKYDNKPEICRAFDLEYRGVEISSGGQREHRHDILVEQIKPHGGFGLGAERLIKQMLDLPNIREV............... 426
51 -14.6003w3s_A mol:protein length:527 Type-2 serine--tRNA ligase  ali model follow..  22  218...................................................................................TPPMAALFEVLRDFLRKLGFEPALFPKLIPLETMFRMR-KRDPELFDDFKREDPGYVLAPAQCEPFYELLREVVDPERLPIKLYDCGWTYRWEGKGLERVNEFQRIEHVWIAEPEERIRRELLEATKRVAEELELE-YLEGRLLEDRDIELPDVPSYEFEVYLPFKGERSSEEAWISVGSF--AGLGVTRWVLAQHGFY.................... 497
52 -14.3001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  15  52.......LPLPESALRVRGLVVENAKAPGGLEVKEVEVLSPALEPTPVEIPKEEWRANPDTLLEYRYVTLRGEKARAPLKVQA-----ALVRGFRRYLDRQDFTEIFTPKVVRAGAEGGSGLFGVDYFEKRAYLAQSPQLYKQIMVGVF---------------RVYEVAPVWRMEEHHTRHLNEYLSLDVEMFIADEEDLMRLEEALLAEMLEEA-VTRYPRSVREEDGTTRSFDLLFRGLEITSGGQRIHRYEELLESLKPHGGFAIGAERLTQKLLGLPNVRYA............... 410
53 -14.2002i4l_A mol:protein length:458 Proline-tRNA ligase  ali model follow..  18..........................................SRFFLPILKENPKEAEIVSHRLMLRAGMLRQEAAGIYAWLPLGVLKKIEQIVREEQNRAGAIELLMPTLQLADLWRESG-AYGPEMLRIADRHKRELLYGPTNEEMITEIFRAYIKSYSLPLNLYHIQWKFRDERFGVMRGREFLMKDAYSFDVDEAGARKKMFVAYLRTFARMGLKAIPMRAETGPIGGD..................................................................... 219
54 -14.2001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  18  20........................................................................................KILEYMTDFFVKEGFKWLLPVIISPITDPLWPDPAGEGMEPAEVEIYGVKMRLTHSMILHKQLAIAMGLK------KIFVLSPNIRLESRQKRHAYEFTQLDFEVERAKMEDIMRLIERLVYGLFRKAVLEEFGSDEKASQEMEEPFWIINIP-EVASGGEREWEYEAKAGKLKPSAGAGIGVERLVRFIVGAKHIAEV............... 281
55 -14.1003j7y_7 mol:protein length:338 mL39  ali model follow..  10  257..IGDFIDVSEGPLIPRTSICFQYEVS-QPSLIRRFQGVSLPLRAHFTIWDKLLERSRKMVTEDQSKATEEC...................................................................................................................................................................................................................................... 335
56 -14.0001ser_A mol:protein length:421 PROTEIN (SERYL-TRNA SYNTHETASE (E.C.6.1.1.11)  ali model follow..  14  44......LQEVQTERNQVAKRVPKAPPEEKEALIARGKALGEEAKRLEEALREKEALDHVALMEKNGWWEPRISQVSGSRSYALKGDLALYELALLRFAARRGFLPMTLPSYAREKAFL--TGHFPAYRDQVWAIAETDLYLTGTAEVVLNALHSEILPYEALPLRYAGYAPAFRSEARGLMRVHQFHKVEQYVLTEASLEASQELLENAEEILRLLELPDIEVYLPSEGRYRETHSCSALDWQARRANLRYRDPEGRVRYAYTLNNTALATPRILAM---LENHQLQDGRVRVPQALI.... 409
57 -13.8001b70_A mol:protein length:350 PHENYLALANYL-TRNA SYNTHETASE  ali model follow..  12  19.......KALKARYLGKKGLLTQEMKGLSALPLEERRKRGQELNAIKAALEAALEAREKALEEAALKEALERERVDVSLPGASLFSITLMERELVEIFRALGYQAVEGPEVENFDALNIPEHHPARDMWDTFWLTGERLLLRTHTSP----MQVRYMVAHTPPFRIVVPGRVFRFEQTDATHEAVFHQLEGLVV--GEGIAMAHLKGAIYELAQALFGPDSKVRFQPVVEPGAQFAVW-KVFQAVDAYRERLGLPPAYRGVTGFA-FGLGVERLAMLRYGIPDIR-----YFFGGRLKF... 342
58 -13.6003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related  ali model follow..  18  20........................................................................................KILDYMTKFFTDRGFKWLLPIMLSPITDPLWPDPAGEGIRPAEVDVYGVRMRLTHSMILHKQLAIAMGLE------KIFVLSPNIRLESRRKDHSYEFTQLDFEIEGAKMKDVMRLIEELIYGLFRKA--REFYDREENGVWKNYDLILPYGYGEVSSGGEREWEYEARAGKLKPSAGAGIGVERLVRFIVGAKHIAEV............... 281
59 -13.5001wle_A mol:protein length:501 Seryl-tRNA synthetase  ali model follow..  15  176...................................................SFQPRGHLEIAEKLDIIRQKRSHVSGHRSYYLRGAGALLQHGLVNFLIHRGFTPMTVPDLLRGVVFEGCG-AKPSQIYNIDPSRFEDLNLAGTAEVGLAGYFMHSVAFRDLPIRMVCSSTCYRAETWGLYRVHHFTKVEMFGVTGPGLEQSEEFLSLQMEILTELGLHDIEAWMPGRGRFGEVTSASNTDFQSRRLHIMFQTEAGELQFAHTVNATGCAVPRLLIA---LESYQQKDGSVLVPPALQ.... 459
60 -13.5003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  22  238.................................................................................VTNIAIFRIQSACREFLTSQKFVEIHTPKLIG-------CSSEGGSNIFEVKYFDRKAYLAQ--SPQLYKQMAIMGDFR----KVFEVGPVFRAENSNTRHLTEFEGLDIEMEIVENYHECIDVME-AIEMLRASGET-YTMPDIDDPNYSNSYDVFVRGQEITSGAQRIHDPEFLMKRCIPHAGCGIGLERITMLYLGIPNIRKVT.............. 537
61 -13.5004v1a_c mol:protein length:334 MITORIBOSOMAL PROTEIN ML39, MRPL39  ali model follow..  11  254..FGDFIDVSEGPLIPRTSICFQYEVS-QSSLVRRFQGLSLPLRAHFTIWNKLLERSRKMVTEDKTKPTEES...................................................................................................................................................................................................................................... 331
62 -13.4002rhq_A mol:protein length:294 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  16  14...............................................HMGTELMEKLNQQLAEETIDVTLPSRQISI-----SKHPLTRTVEEIEDLFLGLGYEIVDGYEVENFEALNLPKSHPARDMQDSFY-ITDEILMRTHTSP--VQARTMEKRNGQGPVKIICPGKVYRRDSDDATHSHQFTQIEGLVV--DKNIKMSDLKGTLELVAKKLFGADREIRLRPSTEPSVEVDVSCFKCKLGAGMVHPNVLEMAGFDSNEYSGFAFGMDRIAMLKYGIEDIR-----YFYTNDVRF... 276
63 -13.2003err_A mol:protein length:536 fusion protein of microtubule binding domain  ali model follow..  14  239...................................................SFPPLDHVALMEKNGWWEPRISQVSGSRSYALKGDLALYELALLRFAARRGFLPMTLPSYAREKAFL--TGHFPAYRDQVWAIAETDLYLTGTAEVVLNALHSEILPYEALPLRYAGYAPAFRSEARGLMRVHQFHKVEQYVLTEASLEASQELLENAEEILRLLELPDIEVYLPSEGRYRETHSCSALDWQARRANLRYRDPEGRVRYAYTLNNTALATPRILAM---LENHQLQDGRV........... 511
64 -13.2003l4g_B mol:protein length:589 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  13  299.................FPELAYRKEMVRADLINKKVGIRETPENLAKLLTRMYIGDGNQIEIEIPPTRADIIHACDIVED-NQFPLNKLTELLRHDMAAAGFTEALTFALCSQEDIADKDISATKAVHISNPKTAEFQVARTTLLPGLLKTIAA-NRKMPLPLKLFEISDIVIKDSNTDVGAKNYRHLCAVYYNKNPG--FEIIHGLLDRIMQLLDVPGYVIKASEGPAFGRCAEIFARGQSVGKGVLHPDVITK-FELTMPCSSLEINIGPFL........................... 589
65 -12.7003pco_A mol:protein length:327 Phenylalanyl-tRNA synthetase, alpha subunit  ali model follow..  15  25.......DNVRVEYLGKKGHLTLQMTTLRELPPEERPAAGAVINEAKEQVQQALNARKAELESAALNARLAAETIDVSLPGRRIENVTRTIDRIESFFGELGFTVATGPEIENFDALNIPGHHPARADHDTFW-FDTTRLLRTQTSG----VQIRTMKAQQPPIRIIAPGRVYRND-YDQTHTPMFHQMEGLIV--DTNISFTNLKGTLHDFLRNFFEEDLQIRFRPSTEPSAEVDVMGKNGKLGCGMVHPNVLRNVGIDPEVYSGFAFGMERLTMLRYGVTDLR-----SFFENDLRF... 322
66 -12.2004wj3_M mol:protein length:599 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  15  72..............VKITGKVRLRPEGARNPNMASIEVLGYELEVLNQAETPPFPLDEYSDVGEETRLRYRFIDLRRPEMAAKLKLRARITSSIRRYLDDNGFLDVETPIL------GRPTPEGARDYLVPSRTYPGHFFALPQ-SPQLFKQLLMVAGF-----RYYQIAKCFRDEDLRADRQPEFTQIDIETSFLDESDIIGITEKMVRQLFKEVEFDEFPHMPEAMRRYGSDKPDLRIPLELVD--VADQLKEVEFKVFSGPANDPKGRVAALRVPGAASMPRSQIDDGIYGAKGLAYIK 358
67 -12.1001eqr_A mol:protein length:590 ASPARTYL-TRNA SYNTHETASE  ali model follow..  14  69..............IQVTGTVRARDEKNINRDMATGEIEVLASSLTIINRADVLPLDSNHVNTEEARLKYRYLDLRRPEMAQRLKTRAKITSLVRRFMDDHGFLDIETPML------TKATPEGARDYLVPSRVHKGKFYALPQ-SPQLFKQLLMMSGF-----RYYQIVKCFRDEDLRADRQPEFTQIDVETSFMTAPQVREVMEALVRHLWLEVDLGDFPVMTEAERRYGSDKPDLRNPMELTD--VADLLKSVEFAVFAGPANDPKGRVAALRVPGGASLTRKQIDEKIYGAKGLAYIK 353
68 -12.0002j3l_A mol:protein length:572 PROLYL-TRNA SYNTHETASE  ali model follow..  12  1..........................................MKQSKMLIPTLREVPNDAEVLSHQILLRARQVAAGIYSYLPLAVLEKLKTIMREEFEKIDAVEMLMPALLPAELWKESG-TYGPNLYRLKDRNDRDYILGPTHEETFTELIRDEINSYRLPLNLYQIQTKYRDERSGLLRGREFIMKDGYSFHADEAQSYRDYEKAYSRIFERCGLEFRAIIGDGSKEFMAISEIGEDTICYSTESDYAANLEMATSLYTPKKSHETQLDLEKIATPEVGTIAEVAN............. 268
69 -12.0004rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  16  78............PEGNENPEIPTGQIEVNATELTVLGESAPLPFQLDEQAGEEARLKYRYLDLRREGPGNALR------------LRSKVNAAARSVLAEHDFVEIETPTL------TRSTPEGARDFLVPARLQPGSFYALPQ-SPQLFKQLLMVAGME----RYYQIARCYRDEDFRADRQPEFTQLDMEMSFVEADDVIAISEQVLKAVWATIGYD-----EEAMRRFGSDKPDLRFGIELVE........................................................ 293
70 -11.9004o2d_A mol:protein length:620 Aspartate--tRNA ligase  ali model follow..  16  90........VEVRPEGNENPEIPTGQIEVNATELTVLGESAPLPFQLDEQAGEEARLKYRYLDLRREGPGNALR------------LRSKVNAAARSVLAEHDFVEIETPTL------TRSTPEGARDFLVPARLQPGSFYALPQ-SPQLFKQLLMVAGME----RYYQIARCYRDEDFRADRQPEFTQLDMEMSFVEADDVIAISEQVLKAVWATIGYD-----EEAMRRFGSDKPDLRFGIELVE........................................................ 309
71 -11.7004p71_C mol:protein length:338 Phenylalanine--tRNA ligase alpha subunit  ali model follow..  14  28..........RVHYLGKKGELTQVMKTLGDLPAEERPKVGALINVAKEKVQDVLNARKTELEGAALAARLAAERIDVTLPGRGQLSVTRTLERIEQCFSRIGYEVAEGPEVENFEALNIPGHHPARAMHDTFY-FNANMLLRTHTSP----VQVRTMESQQPPIRIVCPGRVYRCD-SDLTHSPMFHQVEGLLV--DEGVSFADLKGTIEEFLRAFFEKQLEVRFRPSTEPSAEVDIQCVICSMGCGMVHPNVLRMSNIDPEKFQGFAFGMERLAMLRYGVNDLR-----LFFDNDLRF... 333
72 -11.6002dq0_A mol:protein length:455 Seryl-tRNA synthetase  ali model follow..  13  156...................................................EWKPKLHVDLLEILGGADFARAAVSGSRFYYLLNEIVILDLALLDRLIEKGFTPVIPPYMVRRFVEE--STSFEDFEDVIYKVEDEDLYLIPTAEHPLAGMHAEILDGKDLPLLYVGVSPCFRKEAKGIFRVHQFHKVEQFVYSRPEEEWHEKIIRNAEELFQELEIPDIEAWMPGQGKFREVVDWQARRLNIRFRDRTDEKPRYVHTLNSTAIATSRAIVAILENHQEEDGTVRIPKVL-YTGFKEI... 443
73 -11.3003lsq_A mol:protein length:484 Seryl-tRNA synthetase  ali model follow..  15  214.........................................................................................LVSYSLDFLVKRGYTPFYPPFFLNRDVMGEVASQFDEELYQVSGDGDKKYLIATSEMPIAAYHRGRWFTELKEPLKYAGMSTCFRKEAGAHGRVHQFDKIEQFVVCSPRQEESEDMITTSEEFNKSLGLP-YRV-------------VNICSGALNNAAAKKYDLE-AW---------ASGAFRELVSCSNCTDYQSQSVNCRYGPN...... 411
74 -11.1001efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model follow..  16  64..RPEWVVRAKGLVRLRPEPNPRLATGRVEVELSALEVLA-EAKTPPFPVDAGWRGEEEKEASEELRLKYRYLDLRRRRMQENLRLRHRVIKAIWDFLDREGFVQVETPFL------TKSTPEGARDFLVPYRHEPGLFYALPQ-SPQLFKQMLMVAGL-----RYFQIARCFRDEDLRADRQPDFTQLDLEMSFVEVEDVLELNERLMAHVFREALGVELPLPFP-RLSYEEAMERYGSDKPDLRFGLELKEVGPLFRQSGFRVFQEAESVKALALPKALS.................... 330
75 -10.7003qne_A mol:protein length:485 Seryl-tRNA synthetase, cytoplasmic  ali model follow..  16  189.......................................................................................QALINYGLSFLSSKGYVPLQAPVMMNKEVMAKTASQFDEELYKVIDGEDEKYLIATSEQPAYHAGEWFESPAEQLPVRYAGYSSCFRREAGSHGRVHAFEKIEQFVLTEPEKEEFDRMIGCSEEFYQSLGLP-YRV-------------VGIVSGELNNAAAKKYDLE-AW---------FQQEYKELVSCSNCTDYQSRNLEIRCGIKQQNQQE 394

FFAS is supported by the NIH grant R01-GM087218-01
1 2 4 5 2 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Grynberg M, Godzik A. NERD: a DNA processing-related domain present in the anthrax virulence plasmid, pXO1. Trends Biochem Sci. 2004 Mar;29(3):106-10.