current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 3pco_A mol:protein length:327 Phenylalanyl-tRNA synthetase, alpha subunit, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .
# Score Template Links and tools%idFirst MSHLAELVASAKAAISQASDVAALDNVRVEYLGKKGHLTLQMTTLRELPPEERPAAGAVINEAKEQVQQALNARKAELESAALNARLAAETIDVSLPGRRIENGGLHPVTRTIDRIESFFGELGFTVATGPEIEDDYHNFDALNIPGHHPARADHDTFWFDTTRLLRTQTSGVQIRTMKAQQPPIRIIAPGRVYRNDYDQTHTPMFHQMEGLIVDTNISFTNLKGTLHDFLRNFFEEDLQIRFRPSYFPFTEPSAEVDVMGKNGKWLEVLGCGMVHPNVLRNVGIDPEVYSGFAFGMGMERLTMLRYGVTDLRSFFENDLRFLKQFKLast
1 -136.0003pco_A mol:protein length:327 Phenylalanyl-tRNA synthetase, alpha subunit  ali model  100  1MSHLAELVASAKAAISQASDVAALDNVRVEYLGKKGHLTLQMTTLRELPPEERPAAGAVINEAKEQVQQALNARKAELESAALNARLAAETIDVSLPGRRIENGGLHPVTRTIDRIESFFGELGFTVATGPEIEDDYHNFDALNIPGHHPARADHDTFWFDTTRLLRTQTSGVQIRTMKAQQPPIRIIAPGRVYRNDYDQTHTPMFHQMEGLIVDTNISFTNLKGTLHDFLRNFFEEDLQIRFRPSYFPFTEPSAEVDVMGKNGKWLEVLGCGMVHPNVLRNVGIDPEVYSGFAFGMGMERLTMLRYGVTDLRSFFENDLRFLKQFK 327
2 -126.0004p71_C mol:protein length:338 Phenylalanine--tRNA ligase alpha subunit  ali model follow..  67  1MENLDALVSQALEAVRHTEDVNALEQIRVHYLGKKGELTQVMKTLGDLPAEERPKVGALINVAKEKVQDVLNARKTELEGAALAARLAAERIDVTLPGRGQLSGGLHPVTRTLERIEQCFSRIGYEVAEGPEVEDDYHNFEALNIPGHHPARAMHDTFYFNANMLLRTHTSPVQVRTMESQQPPIRIVCPGRVYRCDSDLTHSPMFHQVEGLLVDEGVSFADLKGTIEEFLRAFFEKQLEVRFRPSFFPFTEPSAEVDIQCKQTGWLEVMGCGMVHPNVLRMSNIDPEKFQGFAFGMGAERLAMLRYGVNDLRLFFDNDLRFLGQFR 338
3 -118.0001b70_A mol:protein length:350 PHENYLALANYL-TRNA SYNTHETASE  ali model follow..  47  1......MLEEALAAIQNARDLEELKALKARYLGKKGLLTQEMKGLSALPLEERRKRGQELNAIKAALEAALEAREKALEEAALKEALERERVDVSLPGASLFSGGLHPITLMERELVEIFRALGYQAVEGPEVESEFFNFDALNIPEHHPARDMWDTFWLTGEGLLRTHTSPMQVRYMVAHTPPFRIVVPGVFRFEQTDATHEAVFHQLEGLVVGEGIAMAHLKGAIYELAQALFGPDSKVRFQPVYFPFVEPGAQFAVWWPEGKWLELGGAGMVHPKVFQAVDAYREGVTGFAFGLGVERLAMLRYGIPDIRYFFGGRLKFLEQFK 347
4 -106.0002rhq_A mol:protein length:294 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  47  1.......................................................MGSSSSGLVPRGSHMGTELMEKLN-----QQLAEETIDVTLPSRQISIGSKHPLTRTVEEIEDLFLGLGYEIVDGYEVEQDYYNFEALNLPKSHPARDMQDSFYITDEILMRTHTSPVQARTMEKRNPVKIICPGKVYRRDSDDATHSHQFTQIEGLVVDKNIKMSDLKGTLELVAKKLFGADREIRLRPSYFPFTEPSVEVDVSCKHTGWIEILGAGMVHPNVLEMAGFDSNEYSGFAFGMGPDRIAMLKYGIEDIRYFYTNDVRFLEQFK 281
5 -103.0003l4g_A mol:protein length:508 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  23  120.ADGPRVFRVVDSMEDEVQRRLQLVRGGQAEKLGEKERSELRKRKLLAEVTLKTYWVSKGSAFSTSISKQETELSPEMISSGSWRDRPFKPYNFLAHGVLPDSGHLHPLLKVRSQFRQIFLEMGFTEMTDNFIESSFWNFDALFQPQQHPARDQHDTFFLRDPAEALQLPMDYVQRVKRTHSPVKYFSIDRVFRNETLDATHLAEFHQIEGVVADHGLTLGHLMGVLREFFTKLGIT--QLRFKPAYNPYTEPSMEVFSYHQGLKWVEVGNSGVFRPEMLLPMGL-PENVSVIAWGLSLERPTMIKYGINNIRELVGHKVNLQMVYD 489
6 -71.1005x6c_A mol:protein length:553 O-phosphoserine--tRNA(Cys) ligase  ali model follow..  16  17.FDIKKVLELAEKDFETAKHIDNKYPRLKPVYGKPHPVMETIERLRQAYLRMGFEEMINPVIVDE--MEIYKQFGPEAMAVLDRCFYLAGLPRPDVGLGNEKVEIIKNLGIDIDEEKKERLREVLHLYKKGAIDGDFEIAKALNVSNEMGLKVLETAFPESTTLTLRSHMTSGWFITLKKRKLPLKLFSIDRCFRREEDRSHLMSYHSASCVVVGEDVSVDDGKVVAEGLLAQFGFTKFKFKPDEKKSKYYTPETQTEVYAYLGEWIEVATFGVYSPIALAKYNID---VPVMNLGLGVERLAMIIYGYEDVRAMVYPQFYEYRLSD 366
7 -70.8002du3_A mol:protein length:534 O-phosphoseryl-tRNA synthetase  ali model follow..  16  3.FDPQKYRELAEKDFEAARSPNELYPRVGFSFGKEHPLFATIQRLREAYLSIGSEVVNPLIVEDVHVKKQFGREALAVLDRCFYLATLPKPNVGISAEKIRQIEAITKREVDSKPLQEIFHRYKKGEIDGDDLS--YLIAEVLDVDDITAVKILDEVFPISSTLTLRSHMTTGWFITLDKLPLPIKLFSIDRCFRQGEDATRLYTYFSASCVLVDEELSVDDGKAVAEALLRQFGFENFRFRKDEKRSKYYIPDTQTEVFAYSDGWIEIATFGIYSPTALAEYDIP---YPVMNLGLGVERLAMILYGYDDVRKMVYPQIHGEIKLS 358
8 -65.8003cmq_A mol:protein length:415 Phenylalanyl-tRNA synthetase, mitochondrial  ali model follow..  30  8................................................................QRAPGSVVELLGKSYPQDDHSNL--TRKVLTRVGRNLHNQQHHPLWLIKERVKEHFYKQYVGRFGTPPVVTTWQNFDSLLIPADHPSRKKGDNYYLNRTHMLRAHTSAHQWDLLHA-GLDAFLVVGDVYRRDQIDSQHYPIFHQLEAVRLFSKLVEFDLKQTLTRLMAHLFGDELEIRWVDCYFPFTHPSFEMEINFHG-EWLEVLGCGVMEQQLVNSAGAQDR--IGWAFGLGLERLAMILYDIPDIRLFWCEDERFLKQFC 308
9 -53.8004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  12  1.....................................................PALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPL-EYIERMGIDNDTELSKQIFRV--DKNFCLRPMVAPNIFNYARKLDPIKIFEIGPCYRKESDGKEHLEEFTMLNFFQMGSGCTRENLESIITDFLNHLGIDFK--IVGDSCSVYGDTLDVMH------GDLELSSAVVGPIPLDREWGIDKP---WIGAGFGLERLLKVKHDFKNIKRAARSESYY..... 260
10 -52.3004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  11  2.................................................................................GSSSSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGFRELESELLSRRKKDLQQIYAEERENEREITRFFVVDKNFCLRPMLAPNLYNYLRKLDPIKIFEIGPCYRKESDGKEHLEEFTMLSFIQMGSGCTRENLESIITDFLNHLGIDFK--IVGDSCMVYGDTLDVMH------GDLELSSAVVGPIPLDREWGIDKP---WIGAGFGLERLLKVKHDFKNIKRAARSESYY..... 278
11 -50.7005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  12  5.............................................................TKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEY-IERMGIDNDTELSKQIFRV--DKNFCLRPMLAPNLYNYLRKLDPIKIFEIGPCYRKESDGKEHLEEFTMLAFAQMGSGCTRENLESIITDFLNHLGIDFK--IVGDSCMVYGDTLDVMH------GDLELSSAVVGPIPLDREWGIDKP---WIGAGFGLERLLKVKHDFKNIKRAARSESYY..... 261
12 -41.1002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  10  2.................................................................................GSSSSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGFRELESELLSRRKKDLQQIYAEERENYLEITRFFVVDKNFCLRPMLAPNLYNYLRKLDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFK--IVGDSCMVYGDTLDVMH------GDLELSSAVVGPIPLDREWGIDKP---WIGAGFGLERLLKVKHDFKNIKRAARSGSYY..... 278
13 -29.2004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  14  8...............................LVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQI-----------YAEERENYLGKLEREITRFFVDRGFLEIKSPILI-----------PLEYIERMGIDNFRVDKNFCLRPMLAPNLGNYLRKLDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIV--GDSCMVFGDTLDVMH------GDLELSSAVVGPRPLDREWGIDKP---WIGAGFGLERLLKVKHDFKNIKRAARSES-YYNGIS 282
14 -28.9004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  15  1.........................................MPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQI-----------YAEERENYLGKLEREITRFFVDRGFLEIKSPILI-----------PLEYIERMGIDNFRVDKNFCLRPMLAPNLANYLRKLDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGID---KIVGDSCMVFGDTLDVMH------GDLELSSAVVGPIPLDREWGIDKP----IGAGFGLERLLKVKHDFKNIKRAARS-ESYYNGIS 265
15 -28.7003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  13  5...............................LVPRGSHGASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEE-----------RENYLGKLEREITRFFVDRGFLEIKSPILIPL---IERMGIDNDTELSKQIFR--VDKNFCLRPMLTPNLYNYLRKLDPIKIFEIGPCYRKESDGKEHLEEFTMLVFWQMGSGCTRENLESIITDFLNHLGIDFKIV--GDSCMVFGDTLDVMH------GDLELSSALVGPIPLDREWGIDKP---WIGAGFGLERLLKVKHDFKNIKRA-ARSESYYNGIS 279
16 -20.3002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  12  13.............................SHMFLTRRDPPLSSFWTKVQYQRLKELNASGEQLEMGFSDALSRDRAFQGIEHQLMSQGKRHLEQLRTVKHRPA-----LLELEEKLAKALHQQGFVQVVTPTIITKS--LAKMTIGEDHPLFSQVFW--LDGKKCLRPMLAPNLYTLWREDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEHQRLEDMARWVLEAAGIREFELVTESS---VYGDTVDVM-----KGDLELASGAMGPHFLDEKWEIFDP---WVGLGFGLERLLMIREGTQHVQSMARS......... 290
17 -14.2001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  13  19.............................................................................................................TKILEYMTDFFVKEGFKWLLPVIISPI----DPLWPDPAGEGMEPAEVEIYGVKMRL-THSMILHKQLAIAMGLKKIFVLSPNIRLESRQKRHAYEFTQLDFEVE---AKMEDIMRLIERLVYGLFRKAEEFEYSEVLIPEVDGFWRNYDLILPYGYGEVASGGE---AKIRKAGLNEDSFRPYGAGIGVERLVRFIVGAKHIAEV............ 281
18 -13.8003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein  ali model follow..  13  19.............................................................................................................TKILDYMTKFFTDRGFKWLLPIMLSPI----DPLWPDPAGEGIRPAEVDVYGVRMRL-THSMILHKQLAIAMGLEKIFVLSPNIRLESRRKRHSYEFTQLDFEIE---AKMKDVMRLIEELIYGLFRKAEEVNIPREFYDREENGVWKNYDL---GYGEVSSGGE---AKIRAAGLKEDSFRPYGAGIGVERLVRFIVGAKHIAEV............ 281
19 -12.3003l4g_B mol:protein length:589 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  11  283..TVEAAEVVFPNGKSHTFPELAYRKEMVRADLINKKVGIRETPENLAKLLTRMYLKSEVIGDGNQIEIEIPPTRADIIHACDIVEDAAIAYGYNNIQMTLPKANQFPLNKLTELLRHDMAAAGFTEALTFALCSQEDIADKLGVDISATKAVHISNPKTAEFQVARTTLLPGLLKTIAANRPLKLFEISDIVIKDSNTDVGAKNYRHLCAVYYNKNPGFEIIHGLLDRIMQLLDVPKGGYVIKASEGPAFFPGRCAEIFARGQ---SVGKLGVLHPDVITKFEL---TMPCSSLEINIGPFL........................ 589
20 -12.0001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  11  69..LIQGLVKANKEGTISKNMVKWAGSLNLEIVLVRGIVKKVDEPIKSATVQNLEIHITKIYTISETPEALPILLEDASRSEAEAEAAGLPVVNLDTRLDYRVIDLRTV-AGVCELFREYLATKKFTEVHTPKLLGA----------PSEGGSSVFEVTYFKGKAYLAQ-SPQFNKQQLIVADFERVYEIGPVFRAENSNTHHMTEFTGLDMEMAFEE-HYHEVLDTLSELFVFIFSE-VRLTYKEGIFPYTMPDPANPKYSNSYDFFEILSGAQLLQERMKAHGLSPEDPG--GGGIGLERVVMFYLDLKNIRRA............ 478
21 -11.9005xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  12  67.......LRDGTGYLQCVLADELCQCYNGVLLSTESSVAVYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAGGADNLINEESDVDVQLNNRHMMIRGENMSK--LKARSMVTRCFRDHFFDRGYYEVTPPTLVQT----------QVEGGATLFKLDYFGEEAFLTQ--SSQLYLETCLPALGDVFCIAQSYRAEQSRTRHLAEYTHVEAECP---LTFDDLLNRLEDLVCDVVDRILKCRFPVEIKSFEDSRLTESVDVLMPNVGEIVGGSM---AGYKREGIDPTPYYWYGYGLGLERFLTWILNRYHIRDV............ 454
22 -11.7003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  13  248.............................................................................................................SACCGLFREFLTSQKFVEIHTPKLIGC----------SSEGGSNIFEVKYFDRKAYLAQ-SPQLYKQMAIMGDFRKVFEVGPVFRAENSNTRHLTEFEGLD-IEMEIVENYHECIDVMEKLFTFIFDE-LRLTYKEAIFPYTMPDIDDPNYSNSYDVFEITSGAQ---KRCIEKGVDPATLKDYGCGIGLERITMLYLGIPNIRKV............ 536
23 -11.7004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  12  104LVAVGDHASKQMVKFAANINKESIVDVEGVVRKVNQKIGSCTQQDVELHVQKIYVISLAEPRLPLQLDDAVRPEAEGEEEGRATVNQDTRLDNRVIDLRTSTSQAVFRLSGICHLFRETLINKGFVEIQTPKIISA----------ASEGGANVFTVSYFKNNAYLAQ-SPQLYKQMCICADFEKVFSIGPVFRAEDSNTRHLTEFVGLD-IEMAFNYHYHEVMEEIADTMVQIFKGKYPLAVRPFYTPKQSNSYDMFM-----RGEEILSGAQLLTERALHHGIDLEKIKAYGGGIGLERVTMLFLGLHNVRQT............ 503
24 -11.6003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  14  53......ELRDGSGYCQCVIFGKELCEPEKVKLLTRECSLEITGRLNAYAGKNHPPEIADILNLEMQVTEWKVIGESPIDLENIINKDSSIPQKMQNRHIVIRSEHTQQVLQLRSEIRKYYHDNHFTEIQPPTIVKT----------QCEGGSTLFKLQYFNEPAYLTQ--SSQLYLESVIASLGKSFCMLSSYRAEQSRTVHLAEYLHLEAELP---ISFEDLLNHLEDLVCTVIDNVMAIHFPSKMKAFGHPDLTESVDLLMPGVGEIVGGSM---GAYKANGLNPDPYYWYGYGLGVERLVMWLLGEDHIRKV............ 444
25 -11.4001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  13  49TAPKKKVDPELFKLIPKLRSEDVVAVEGVVNFTPKAKFEILPEKIVVLNRAETPLPLDPTGKVKAELDTRLNNRFMDLRRPEVMAIFKIR-------------------SSVFKAVRDFFHENGFIEIHTPKIIAT----------ATEGGTELFPMKYFEEDAFL-AESPQLYKEIMMASGLDRVYEIAPIFRAEEHNTTHLNEAWSIDAFIEDEEEVMSFLERLVAHAINYVREHNARVSYDKALYPYIMKYDNKPEICRAFDLEEISSGGQILVEQIKEKGLNPESFEFYGFGLGAERLIKQMLDLPNIREV............ 426
26 -11.4002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  11  36......ILRDGTGFLQVLLMDKLCQTYDALTVNTECTVEIYGAIKEVPEGKEAPNGHELIADFWKIIGNAPPGGIDNVLNEEASVDKMLDNRHLVIRGENAAA--LRLRAAATRAMREHFYNAGYVEVAPPTLVQT----------QVEGGSTLFNLDYFGEQSFL-TQSSQLYLETCIPTLGDVFCIAQSYRAEKSRTRRHLAEYAHVEAECP---ITLDDLMEKIEELVCDTLLNRFPSEIKAFYMNTLTESVDLLM-----GVGEIVGGSM---KAFKNVEIDPKPYYWYGYGLGLERFICWLTNTNHIRDV............ 425
27 -11.0003g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  15  21.............................................................................................................AAIMAEIRRFFADRGVLEVETPCMSQA--HLFPFETRFVGPGHSQGINLYLMT-------SPEYHMKRLLAAGCGPVFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDMYMNEVDDLLQQVLDCQPAESLSYQLQLLFTMGVEPHIGKEKPTFIYHFFEVYYKGIIDQNLLDALAAGLPDCSGV--ALGVDRLVMLALGAESLADVI........... 319
28 -10.9001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  14  22LHWRRDLGRIQFLLLRDRSGVVQVVTGGLKLPLPESALNAKAPGGLEVQAKEVEVLSPALEPTPVEIPKEEWRANPDTLLEYRYVTLRGEKARAPLKVQ----------AALVRGFRRYLDRQDFTEIFTPKVVRA----------GAEGGSGLFGVDYFEKRAYL-AQSPQLYKQIMVGVFERVYEVAPVWRMEEHHTSRHLNEYLSLD-VEMGFIADEEDLMRLEEALLAEMFVTRYPRSVRPFYTYPEEDGTSFDLLFRG---LEITSGGQ---ESLKAKGMDPEAFHGYGFAIGAERLTQKLLGLPNVRYA............ 410
29 -10.6001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  15  64................TQESVIQVRGIVKADKRAPRGIELHAEEITLLSKAKAPLPLDVSGKVKADIDTRLRERVLDLRRQEMQAVIKIQ-------------------SLALKAFRETLYKEGFIEIFTPKIIAS----------ATEGGAQLFPVIYFGKEAFLAQ--SPQLYKELMAGVVERVFEVAPAWRAEESDTPHLAEFISMDVEMA---ADYNDVMQLLEKILHNIVKTDWPSDARPFYTKSKSENPELSESFD--KFLEIVSGSTVLEEALKKKGLKPESFEFFGFGMGLARLMVMLTGIQSVKEI............ 417
30 -10.3003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  16  34.............................................................................................................AAIMAEIRRFFADRGVLEVETPCMSQA--HLVPFETRFVGPGHSQGMNLWLMT-------SPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYMNEVDDLLQQVLDCPAAESLSYQ-KPTFFPASQASLEVYYK--ANGFHELTDAREQQQRFLPQHPIDQNLIEALKVGMGVDRLVMLALGAETLAEVI........... 332
31 -10.30011as_A mol:protein length:330 ASPARAGINE SYNTHETASE  ali model follow..  11  8........................................................................................................KQRQISFVKSHFSRQLEELGLIEVQAPILSRVGDGTQDNLSGAEKAVQVKVKALPDAQFEVVHSLAKRQTLGQHDFSAGEGLYTHMKALRPDELSPLHSVYVDQWERVMGDGERQFSTLKSTVEAIWAGIKATEAAVSEE-DYDDWSTPSELGHAGLNGEDAFELSSMGILKHQLALTGDEDRLELEWHGGGIGQSRLTMLLLQLPHIGQVQAG......... 316
32 -10.3001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  11  38......WIRDSTGIVQAVVAKNVVGEETFEKA-KKLGRESSVIVEGIVKADERAPGGAEVHVEKLEVIQAVSEFPIPENPEQASPELLLDYRHLHIRTPKASA--MKVKETLIMAAREWLLKDGWHEVFPPILVTG----------AVEGGATLFKLKYFDKYAYLSQSAQLYLEAAIFGLEK---WSLTPSFRAEKSRTRHLTEFWHLELEAA---MDLWDIMKVEEELVSYMFVYGYPKHIKAFYMPRKVLASDMLA----EGYGEIIGGSQREDDYILEEGMDPKDYEWYGFGLGVERLVAWVLKLDHIRWA............ 422
33 -9.6604lns_A mol:protein length:351 Asparagine synthetase a  ali model follow..  12........................................................................................................LQEQILTVKRSFSEALEKLNLVEVRAPILFRVGDGTQDNLSGFEKAVQVPVKAIPNASFEVVHSLAKRRTLANYKFAPGHGLYTHMTALRVDDLDNIHSVVVDQWD-VMKDDQRNLAFLKEVVCKVYAAIRKTELAVCEK-LAYPNLTAKEREREIAREYG-LEVSSMGILRHQISLTGDDSLLKSEWHGGGIGQSRMVMFMLRKKHIGEVQCS......... 338
34 -9.4203mey_A mol:protein length:346 Bll0957 protein  ali model follow..  10  1.....................................MGSSSSGLVPRGSHMNIAVLPNSPDTAPQIADPLDHLADK------------LFHSMGSDGVYARTALYESIVERLAALITSHREAGTEALRFPPVEREINAAVSRFDAGGDWTTSLSPADLVLSPAACYPVYPIAASRGPLPKGGLRFDVAADCFRREP-HLDRLQSFRMREYVCIGTPDDVSDFRERWMVRAQAIARDGLTFRVDYASDPFQQLKFELLIPLRSEEPTACMSFNYHREHFGTTWGINGEPAHTGCVAFGMDRLAFHTHGTDKVRDILGLQ........ 327
35 -9.2603a74_A mol:protein length:493 Lysyl-tRNA synthetase  ali model follow..  13  91..RQDDVGEQQYELFKISDLGDIVGVRGTMFKTKVGELSIKVSSYEFLTKALRPLPEK------KDIEQRYRQRYLDLIMNPESKKTFITR------------------SLIIQSMRRYLDSHGYLEVETPMMHAVAGGAAARPFITHHNALDMTLYMRIAIELHLKRLIVGGLEKVYE---------IGRVFRNEGISTRHNPEFTMLELYEAYADFRIMKLTENLIAHIATEVLGTTKIQYGEHLVDLTPEGVEVAPHMTFGHIVNEFFEQKVEDKLIQPTFI-PVEISPLALGIGVDRLVMLLTNSPSIRDVL........... 485
36 -9.2401e1o_A mol:protein length:504 LYSYL-TRNA SYNTHETASE, HEAT INDUCIBLE  ali model follow..  14  87.......LQDVGGRIQLYVARDSLPEGVYNDQFKKWDLGDIIGARGTLFKTQTGELSIHCTELRLLTKALRPLPDKFHGLQDQEVRYRQRYLDLIANDKSRQTFVVR--SKILAAIRQFMVARGFMEVETPMMQVIPGGASARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFE---------INRNFRNEGISVRHNPEFTMMELYMAYADYHLIELTESLFRTLAQEVLGTTKVTYGEHVFDFGKPGITVEKSWGLGRIVTEIFDEVAEAHLIQPTFI-PAEVSPLALGIGIDRMIMLFTNSHTIRDVI........... 495
37 -9.1904h2w_A mol:protein length:346 Amino acid--[acyl-carrier-protein] ligase 1  ali model follow..  10  1.....................................MGSSSSGLVPRGSHMNIAVLPNSPDTAPQIADPLDHLADK------------LFHSMGSDGVYARTALYESIVERLAALITSHREAGTEALRFPPVEREINAAVSRFDAGGDWTTSLSPADLVLSPAACYPVYPIAASRGPLPKGGLRFDVAADCFRREP-HLDRLQSFRMREYVCIGTPDDVSDFRERWMVRAQAIARDGLTFRVDYASDPFQQLKFELLIPLRSEEPTACMSFNYHREHFGTTWGIQDANGEPACVAFGMDRLAFHTHGTDKVRDILGLQ........ 327
38 -9.1701bbu_A mol:protein length:504 PROTEIN (LYSYL-TRNA SYNTHETASE)  ali model follow..  14  87.......LQDVGGRIQLYVARDDLPEGVYNEQFKKWDLGDILGAKGKLFKTKTGELSIHCTELRLLTKALRPLPDKFHGLQDQEARYRQRYLDLISNDESRNTFKVR--SQILSGIRQFMVNRGFMEVETPMMQVIPGGAAARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFE---------INRNFRNEGISVRHNPEFTMMELYMAYADYKLIELTESLFRTLAQDILGKTEVTYGDVTLDFGKPGIHVEKSWGLGRIVTEIFEEVAEAHLIQPTFI-PAEVSPLALGIGIDRMVMLFTNSHTIRDVI........... 495
39 -9.0203ica_A mol:protein length:213 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  1.......................................................................................................SNADRRYKWQTVVSEQLVGAGFNEILNNSLTAGSYYEGLKSHPREMAVEPLSQELNCMRQTLLFGGLETLSHNLRRKHLSLYLFEWGKCYRAKRTDETPLAAYAEDDRLGIEEPTSVFELKAVVEQVLCRVGIETGAYTLKTAD-NDLYASAMEVKTRSGK---LLGTFGTVSTELIKRFEIEQP---VYFAELLWDALM........................ 213
40 -9.0104ex5_A mol:protein length:529 Lysine--tRNA ligase  ali model follow..  15  115..TPADVGAETYDAFKKWDLGDIVAARGVLFRTNKGELSVKCTQLRLLAKALRPLPDKFHG---ADQETRYRQRYVDLIVTPETRTTFRAR------------------TKAIASIRKFMGDADFMEVETPMLHPIPGGAAAKPFVTHHNALDMEMFLRIAPELYLKRLIVGGFERVFE---------INRNFRNEGVSPRHNPEFTMMEFYAAYTDYRLMDFTERLIRQAAVDALGTATIQYQGRELDLAQPFHRLTITQAIQKYAETAEAQLWEPTFIEAMFFDADYIRALGCGIGIDRLVMLLTDSPTIRDVL........... 514

FFAS is supported by the NIH grant R01-GM087218-01
1 2 5 9 6 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24