current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 3qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280
# Score Template Links and tools%idFirst MKGGLVPRGSHGASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLTPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLVFWQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSALVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNLLast
1 -126.0003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model  100  1MKGGLVPRGSHGASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLTPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLVFWQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSALVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 282
2 -119.0004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  97  5.SSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLSFIQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 285
3 -119.0002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  96  5.SSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSGSYYNGISTNL 285
4 -116.0004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  98  2...............PALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLANYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 268
5 -115.0004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  96  5.SSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLGNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPRPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 285
6 -114.0004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  96  1...............PALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMVAPNIFNYARKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFFQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCSVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 267
7 -81.2002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  38  15....MFLTRRDPPLSSFWTKVQYQRLKELNASGESDALSRDRAFQGIEHQLMSQGKRHLEQLRTVKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEDHPLFSQVFWLDGKKCLRPMLAPNLYTLWRELERLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEHQRLEDMARWVLEAAGIEFELVTESSVVYGDTVDVMKGDLELASGAMGPHFLDEKWEIFDPWVGLGFGLERLLMIREGTQHVQSMARSLSYLDGVRLNI 301
8 -47.7003l4g_A mol:protein length:508 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  17  161.KRKLLAEVTLKSKGSAFSTSISKQETELSPEMISSGSWRDRPFKP-------YNFLAHGVLPDSGHLHPLLKVRSQFRQIFLEMGFTEMPTALFQPQQHPARDQHDTFGYKYNWKLDEARKNLLRTHTTSASARALYRLAQKKPTPVKYFSIDRVFRNETLDATHLAEFHQIEGVVADHGLTLGHLMGVLREFFTKLGITQLRFKPAYNPYTEPSQGLKKWVEVGNSGVFRPEMLLPMGLPESVIAWGLSLERPTMIKYGINNIRELVGHKVNLQMVYDS. 490
9 -37.9002du3_A mol:protein length:534 O-phosphoseryl-tRNA synthetase  ali model follow..  15  2...................KFDPQKYRELAEKDFEAAWKAGKEILAERSPNELYPRVGF----SFGKEHPLFATIQRLREAYLSIGFSEVVNPLIVEDVHVKKQFGREA-PEFKELKPISSTLTLRSHMTTGWFITLSHIADKLPLPIKLFSIDRCFRREQGDATRLYTYFSASCVLVDEELSVDDGKAVAEALLRQFGFENFRFREKRSKYYIPDTQTEGWIEIATFGIYSPTALAEYDIPYPVMNLGLGVERLAMILYGYDDVRKMVYPQIHGEIKLSDL 360
10 -35.7002du7_A mol:protein length:549 O-phosphoseryl-tRNA synthetase  ali model follow..  14  2.........KLKHKRDDKMRFDIKKVLELAEKDFETAWRE----TRALIKDKHIDNKYPRLKPVYGKPHPVMETIERLRQAYLRMGFEEMINPVIVPEAMAVLDVLETAFPEFKDLKPESTTLTLRSHMTSGWFITLSSLIKKRKLPLKLFSIDRCFRREQRDRSHLMSYHSASCVVVGEDVSVDDGKVVAEGLLAQFGFTKFKFKEKKSKYYTPETQTEEWIEVATFGVYSPIALAKYNIDVPVMNLGLGVERLAMIIYGYEDVRAMVYPQFYEYRLS... 361
11 -34.8003g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  18  15.................................................................PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPFETRFVGPGHSQGINLYLMTSPEYHMKRLL------AAGCGPVFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDMYMNEVDDLLQQVLDCQPAESLSYQQAFQRHLEIDPLSADKTQLREAALFTMGVEPHIGKEKPTFIYHFPASQASLAQISTEDHRVAERFEVYYKGIEL.. 246
12 -34.4003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  17  28.................................................................PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGPGHSQGMNLWLMTSPEYHMKRLL------VAGCGPVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPLSADKTQLREVALFTFGVEPNIGKEKPTFVYHFPASQASLAQISTEDHRVAERFEVYYKGIEL.. 259
13 -33.0001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  13  3.................................................RLQIEKIRGFRDFYPEDMDV-EKFIFKTAEEAAEAFGFRRIDFPSLEYLDLYIKSGEELLQQTYSFVDKGGREVTLIPEATPSTVRMVTSR-KDLQRPLRWYSFPKVWRYEEPQAGRYREHYQFNADIFGSDSPEADAEALASSILDRLGLQDIYINSRKIMEEIIGGMTSSDPFSVFSIIDRYHKISREEFVDQLRSAGIGEDGVSMIADLCSGTRGIDE............ 227
14 -31.7001b70_A mol:protein length:350 PHENYLALANYL-TRNA SYNTHETASE  ali model follow..  16  29.KGLLTQEMKGLSALPLEERRKRGQELNAIKAALEAALEAREKALEEAALKEALERERVDVSLPGGGLHPITLMERELVEIFRALGYQAVEGPEVEPEHHPARDMWDTFRLEGPLGEEVEGRLLLRTHTSPMQVRYMVAH----TPPFRIVVPGRVFRFEQTDATHEAVFHQLEGLVVGEGIAMAHLKGAIYELAQAL--SKVRFQPVYFPFVEPGAQFGKWLELGGAGMVHPKVFQAVDAYRE-FAFGLGVERLAMLRYGIPDIRYFFGGRLKF....... 342
15 -31.3001z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subu  ali model follow..  12  4........................................SGSIEGRMEKINYLLPEESAEMTLNQVKSLR-QIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGKEKMFQFIKHEGQSITLRYDFTLPLVRLYSQIKD--STSARYSYFGKIFRKEKRHKGRSTENYQIGIELFGESADKSELESLALQVIEQLGLNKTVFEIGSAKFFQRLCQLADGST.......................................................... 190
16 -30.8002rhq_A mol:protein length:294 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  16  1.........................MGSSSSGLVPRGSHMGTELMEKLNQQLAEETIDVSRQISIGSKHPLTRTVEEIEDLFLGLGYEIVDGYEVEPKSHPARDMQDS--------FYITDEILMRTHTSPVQARTMEK--RNGQGPVKIICPGKVYRRDSDDATHSHQFTQIEGLVVDKNIKMSDLKGTLELVAKKL--REIRLRPSYFPFTEPSVEVTGWIEILGAGMVHPNVLEMAGFDSNEFAFGMGPDRIAMLKYGIEDIRYFYTNDVRF....... 276
17 -29.6003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  20  1...............MAMGTLEAQTQGPGSMQKNMVETEPVQGCRDFPPEAMRCRRH----------------LFDVFHATAKTFGFEEYDAPVLESEEYIRKAGEEITEQMFNFITKGGHRVALRPEMTPSLARLLLGKGRSLLLPAKWYSIPQCWRYEAITRGRRREHYQWNMDIVGVKSVSAEVECAACWAMRSLGLSSKDVG----------------IKVNSRKV----------LQTVVEQAGVTSDKFAPVCVIVDKMEKIPREEVEAQLAVLGL 228
18 -29.4003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  20  1...............MAMGTLEAQTQGPGSMQMNMVETEPVQGCRDFPPETMRLRKY----------------LFDVFHSTARKFGFEEYDSPVLESEEYIRKAGEEITEQMFNFITKGGHRVALRPEMTPSLARQLLAKGRSLLLPAKWYSIPQCWRYEAITRGRRREHYQWNMDIIGVKSVSSEVECAACTAMQSLGLSSKDVG----------------VKINSRKI----------LQTVVEQAGVSADKFAPVCVIVDKMEKLPREEVVAQLAAIGL 228
19 -29.0003pco_A mol:protein length:327 Phenylalanyl-tRNA synthetase, alpha subunit  ali model follow..  17  35.KGHLTLQMTTLRELPPEERPAAGAVINEAKEQVQQALNARKAELESAALNARLAAETIDVSLPGGGLHPVTRTIDRIESFFGELGFTVATGPEIEPGHHPARADHDT--------FWFDTTRLLRTQTSGVQIRTMKAQ----QPPIRIIAPGRVYRNDY-DQTHTPMFHQMEGLIVDTNISFTNLKGTLHDFLRNF---QIRFRPSYFPFTEPSAEVGKWLEVLGCGMVHPNVLRNVGIDPEVFAFGMGMERLTMLRYGVTDLRSFFENDLRF....... 322
20 -28.9001qe0_A mol:protein length:420 HISTIDYL-TRNA SYNTHETASE  ali model follow..  16  1...................................................MIKIPRGTQDILPEDSKKWRY-IENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSTDEMYTFKDKGDRSITLRPEGTAAVVRSYIEMQGNPNQPIKLYYNGPMFRYERKQKGRYRQFNQFGVEAIGAENPSVDAEAMVMHIYQSFGLKHLKLVINSVGDMASRKEYNEAL........................................................... 179
21 -28.7004rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  18  2.................................................PMTARAVRGTKDLFGKELRMHQR-IVATARKVLEAAGALELVTPIFEETQVFEKGVGAATDEMFTFQDRGGRSLTLRPEGTAAMVRYLEHGMKVWPQPVRLWMAGPMFRAERPQKGRYRQFHQVNYEALGSENPILDAEVLLYECLKELGLRRLKVKLSSVGDPEDRARYNAYL........................................................... 181
22 -27.8004p71_C mol:protein length:338 Phenylalanine--tRNA ligase alpha subunit  ali model follow..  18  35.KGELTQVMKTLGDLPAEERPKVGALINVAKEKVQDVLNARKTELEGAALAARLAAERIDVTLPGGGLHPVTRTLERIEQCFSRIGYEVAEGPEVEPGHHPARAMHDT--------FYFNANMLLRTHTSPVQVRTMESQ----QPPIRIVCPGRVYRCDS-DLTHSPMFHQVEGLLVDEGVSFADLKGTIEEFLRAF--LEVRFRPSFFPFTEPSAEVTGWLEVMGCGMVHPNVLRMSNIDPEKFAFGMGAERLAMLRYGVNDLRLFFDNDLRF....... 333
23 -26.9004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  15  30........................................................KGMNDILPQDAGLWEF-FEATVKSLLRAYGYQNIRTPIVEHTPLFTRGIGEVTDIVEKEMYSNGENLTLRPENTAAVVRAAIEHNMLYDGPKRLWYIGPMFRHERPQRGRYRQFHQVGVEALGFAGPDADAEMMCQRLWEDLGLTGIKLEINSTVFEWVTDKLGAQGTVAAGGRYDPLIEQLGGKPTAACGWAMGIERILELLKEEHLVPEQEGVDVYV....... 353
24 -25.7002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  16  4............................................YQDPMAKNIQAIRGMNDYLPGETAIWQR-IEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDEMYTFEDRNGDSLTLRPEGTAGCVRAGIEHGLLYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDIDAEMLTARWWRALGISEHV.............................................................................. 168
25 -25.2005e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  16  10........................................................KGFNDVLPTQTAAWRR-LEQHLASLMDAYGYQQIRLPIVEQTGLFKRAIGDATDIVEKEMYTPPESLTLRPEGTAGCVRALVEHNLLRGATPRVWYMGPMFRYEKPQKGRYRQFHQFGVETFGVATPDIDAEMLTARLWKRMGVDHMV.............................................................................. 164
26 -25.1003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  15  20.................................................RGFADRPPGMQDGYPDFAKR-RRAVETRLLSFVEDAGYEPVTSGLFEYVDTLLRASPESSRDWIRLFDGGGDAVALRPEMTPSIARMAAPRVAAGRTPIRWCYCERVYRRTDDPSGKAAESTQVGIERIGEEASVDDVLRLLHEASAAAGVRHHRIV............................................................................ 185
27 -24.8003od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subu  ali model follow..  14  2............................................NAMSKPFMFEKPFGMRDTLPEWYKT-KKNICDQMTEEINLWGYDMIETPTLEYYETVGVVSAILDQQLFKLLDQQGNTLVLRPDMTAPIARLVASSLKDRAYPLRLAYQSNVYRAQQNEGGKPAEFEQLGVELIGDGTASADGEALMIAALKRAGLSEFKVAIGHVGYVNALLMDVVGNEQRADRLRRFLYEKNY----------VGYREHVKSLNLSTIDKSRLMNLLSLRG..... 225
28 -23.8003ig2_A mol:protein length:213 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  18  8........................................................................KLQNLVAEQLVGCGFNEILNNSLTRAAYYDGLESYPSKNLVMLLNPLSADLCMRQTLLFGGLESIAHNANRKNADLKFFEFGNCYHFDAEKKNPYSEDYHLGLWVTGKMVSNSELKAYVENIFKRLGLDLHSLVVGNL--TALTVNTKGGKRLATFGVVTKKMLKAFDVDNEVYYADLNWKELM.......................... 213
29 -23.5003a74_A mol:protein length:493 Lysyl-tRNA synthetase  ali model follow..  16  144........................................PEKYHGLKDIEQRYRQRYLDLIMNPESKKTRSLIIQSMRRYLDSHGYLEVETPMMHAV-----AGGAAARPFITHHNALDMTLYMRIAIELHLKRLI------VGGLEKVYEIGRVFRNEGISTRHNPEFTMLELYEAYAD--FRDIMKLTENLIAHIAVDLTPEWRRLHMVDAIKEYVGVDFWRQMSDEEARELAKEHGVEQPTFIYGHPVEISPLAKKNPDDPRFTDRFELFIVGREH.. 412
30 -23.1003ica_A mol:protein length:213 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  18  8........................................................................KWQTVVSEQLVGAGFNEILNNSLTAGSYYEGLKSHPREMAVELMNPLSQELCMRQTLLFGGLETLSHNLRRKHLSLYLFEWGKCYRFHAAKRTDYAEDDRLGIWICGQRVHNSELKAVVEQVLCRVGIETGAYTLKTA--SAMEVKTRSGKLLGTFGTVSTELIKRFEIEQPVYFAELLWDALM.......................... 213
31 -23.0001bbu_A mol:protein length:504 PROTEIN (LYSYL-TRNA SYNTHETASE)  ali model follow..  17  153........................................PDKFHGLQDQEARYRQRYLDLISNDESRNTRSQILSGIRQFMVNRGFMEVETPMMQVIP-----GGAAARPFITHHNALDLDMYLRIAPELYLKRLV------VGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYAD--YKDLIELTESLFRTLA--QDILGKTEVTYGEAIKKYRPETDMADTEIFEEVAEAH--LIQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREI.. 422
32 -23.0001e1o_A mol:protein length:504 LYSYL-TRNA SYNTHETASE, HEAT INDUCIBLE  ali model follow..  16  153........................................PDKFHGLQDQEVRYRQRYLDLIANDKSRQTRSKILAAIRQFMVARGFMEVETPMMQVIP-----GGASARPFITHHNALDLDMYLRIAPELYLKRLV------VGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYAD--YHDLIELTESLFRTLA--QEVLGTTKVTYGEAIKKYRPETDMADTEIFDEVAEAH--LIQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREI.. 422
33 -22.6003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  15  15.......................................................PSGFPEFLPSEKRL-ELYLLDTIRRVYESYGFTPIETPAVERLEVLQAKGNQGDNIIYG-GDTGSEARALKFDQTVPLAAYIARHLNDLTFPFARYQMDVVFRGERAKDGRFRQFRQCDIDVVGREKYDAQMPAIITEIFEAVNIGDFVIRINNR-FFQSLNISETQIKSCISIIDNLEKIGEAKVKLELEKEGINPEQTQKI........................ 239
34 -22.3004ex5_A mol:protein length:529 Lysine--tRNA ligase  ali model follow..  16  168........................................PDKFHGLADQETRYRQRYVDLIVTPETRTARTKAIASIRKFMGDADFMEVETPMLHPIP-----GGAAAKPFVTHHNALDMEMFLRIAPELYLKRLI------VGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTD--YRWLMDFTERLIRQAAITQAIQKYAPSYTDGQLSDDAFLRSELKRALFEETAEAQ--LWEPTFIIDYPIEVSPLARESDTVAGITERFELFITGREI.. 441
35 -22.2003bju_A mol:protein length:521 Lysyl-tRNA synthetase  ali model follow..  20  146........................................PHLHFGLKDKETRYRQRYLDLILNDFVRQIRSKIITYIRSFLDELGFLEIETPMMNIIP-----GGAVAKPFITYHNELDMNLYMR------IAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYAD--YHDLMEITEKMVSGM.................................................................................... 293
36 -22.1003cmq_A mol:protein length:415 Phenylalanyl-tRNA synthetase, mitochondrial  ali model follow..  16  42..............................................................LHNQQHHPLWLIKERVKEHFYKQYVGRFGTPLFSPADHPSRKKGDN--------YYLNRTHMLRAHTSAHQWDLLHA------GLDAFLVVGDVYRRDQIDSQHYPIFHQLEAVRLAVKLVEFDLKQTLTRLMAHL---EIRWVDCYFPFTHPSFEMEEWLEVLGCGVMEQQLVNSAGAQDRIWAFGLGLERLAMILYDIPDIRLFWCEDERF....... 303
37 -21.9004up7_A mol:protein length:777 LYSINE--TRNA LIGASE  ali model follow..  20  144........................................PSMHYGLGDQETRFRKRYLDLIVNPESVKLRTKVVKAVRKYLDDKGFLEVETPILNTIP-----GGATARPFITHHNQLDIQMYMR------IAPELYLKELVVGGINRVYEIGRLFRNEGIDQTHNPEFTTCEFYMAYAD--YNDIMKMTEELLGNM.................................................................................... 291
38 -21.4004ycv_A mol:protein length:516 Lysine--tRNA ligase  ali model follow..  19  151.............................................GLKDTEIRYRQRYLDLLINESSRHTRTKIINFLRNFLNERGFFEVETPMMNLIA-----GGANARPFITHHNDLDLDLYLR------IATELPLKMLIVGGIDKVYEIGKVFRNEGIDNTHNPEFTSCEFYWAYAD--YNDLIKWSEDFFSQLNTILEQPFDSNETIEKMINIIKEKIELPNPPTAAKLLDQLASNDKPFFIVEHPQIMSPLAKYHRTKPGLTERLEMFICGKEV.. 426
39 -20.6003mey_A mol:protein length:346 Bll0957 protein  ali model follow..  17  57......................................................................YESIVERLAALITEAGTEALRFPPVMSRAQLEKSGSRFDAGGDWTTSLSPADLVLSPAACYPVYPIAASRGPLPKGGLRFDVAADCFRRESKHLDRLQSFRMREYVCIGTPDDVERWMVRAQAIARDLGLTFRVDYASDPFFGRPLRSEEQPTACMSFNYHREHFGTTWGIQDATGCVAFGMDRLAVA........................ 304
40 -20.4001usy_A mol:protein length:275 ATP PHOSPHORIBOSYLTRANSFERASE REGULATORY SUBU  ali model follow..  18  7........................................................................EKVFSFYSKATKKGFSPFFVPALEKAEEPA---------GNFFLDRKGNLFSIREDFTKTVLNHRKRYSP--DSQIKVWYADFVYRYSG---SDLVAEYQLGLEKVPRNSLDDSLEEIIVESASEFFEGPVIVE............................................................................ 128
41 -20.3004h2w_A mol:protein length:346 Amino acid--[acyl-carrier-protein] ligase 1  ali model follow..  17  57......................................................................YESIVERLAALITEAGTEALRFPPVMSRAQLEKSGSRFDAGGDWTTSLSPADLVLSPAACYPVYPIAASRGPLPKGGLRFDVAADCFRRESKHLDRLQSFRMREYVCIGTPDDVERWMVRAQAIARDLGLTFRVDYASDPFFGRPLRSEEQPTACMSFNYHREHFGTTWGIQDATGCVAFGMDRLAVA........................ 304
42 -19.7004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  16  6............................................FELRRQFVLKTPKGTRDYSPRQMA--REKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLT---NIKRYHIAKVYRRDNPTRGRYREFYQCDFDIAGNFDPMAECLKIMCEILSSLQIGDFLVKVNDRRILDTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVAD--VQQHGGVSLVEQLLQDPKLSQNKQALEGLG... 258
43 -19.5004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  15  19..EELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGP--DESKQKFVLKTPKGTRDYSPRQMA--REKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLT---NIKRYHIAKVYRRDNPTRGRYREFYQCDFDIAGNFDPMAECLKIMCEILSSLQIGDFLVKVNDRRILDTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVAD--VQQHGGVSLVEQLLQDPKLSQNKQALEGLG... 311
44 -18.8003l4g_B mol:protein length:589 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  15  388.................................................................ANQFPLNKLTELLRHDMAAAGFTEALTFALCSQEDIADKLISATKAVHISNPKTAEFQVARTTLLPGLLKTIAANRKM-PLPLKLFEISDIVIKDSNTDVGAKNYRHLCAVYYNKNPGFEIIHGLLDRIMQLLDVPPGEDKGGYVI-GRCAEIFARGQSVGKLGVLHPDVITKFELTMPCSSLEINIGPFL.......................... 589
45 -18.5001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  19  75..EGVVNFTPKAKLGFEIL---PEKIVVLNRAETPLPLDPTGKVKAELDTRLNNRFMDLRRPEVMAIFKIRSSVFKAVRDFFHENGFIEIHTPKI-----IATATEGGTELFPMKYFEEDAFLAESPQ--------LYKEIMMASGLDRVYEIAPIFRAEEHNTRHLNEAWSIDSE-MAFIEDEEEVMSFLERLVAHAGKEYIMKYDNKPEICRAFDLEYRGVEISSGGQREHRHDKEKGLNPESFGFGLGAERLIKQMLDLPNIREV.............. 426
46 -17.8001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  22  12................................................................SPTLDIQTKILEYMTDFFVKEGFKWLLPVIISPITDPLWPDPAGEGMEPAEVEIYGVKMRL------THSMILHKQLAIAMGLKKIFVLSPNIRLESRQKRHAYEFTQLDFEVERAK--MEDIMRLIERLVYGLGYGEVASGGEREWEYEKIVAKIRKAGLNEDSFRPYLEIAKAGKLKPSAGAGIGVERLVRFIVGAKHIAEV.............. 281
47 -17.7001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  15  72..RGIVKADKRAPRGIELH---AEEITLLSKAKAPLPLDVSGKVKADIDTRLRERVLDLRRQEMQAVIKIQSLALKAFRETLYKEGFIEIFTPKIIASATEGGAQLFPVIYFGKEAFLAQSPQLYKELMAGVV---------------RVFEVAPAWRAEESDTFHLAEFISMDVEMA---ADYNDVMQLLEKILHNIGYNYTKSKSENPELSESFDLIYKFLEIVSGSTRNHKREKKKGLKPESFGFGMGLARLMVMLTGIQSVKEI.............. 417
48 -17.5003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related  ali model follow..  23  16....................................................................DIQTKILDYMTKFFTDRGFKWLLPIMLSPITDPLWPDPAGEGIRPAEVDVYGVRMRL------THSMILHKQLAIAMGLEKIFVLSPNIRLESRRKRHSYEFTQLDFEIEGAK--MKDVMRLIEELIYGLGYGEVSSGGEREWEYEKIVAKIRAAGLKEDSFRPYLEIARAGKLKPSAGAGIGVERLVRFIVGAKHIAEV.............. 281
49 -16.9001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  17  62..RGLVVENAKAPGGLEVQAKEVEVLSPALEPT----EIPKEEWRANPDTLLEYRYVTLRGEKARAPLKVQAALVRGFRRYLDRQDFTEIFTPKVVRAGAEGGSGLFGVDYFEKRAYLAQSPQLYKQIMVGVF---------------RVYEVAPVWRMEEHHTRHLNEYLSLDVE-MGFIADEEDLMRLEEALLAEMSVRPFYTYPEEDGTTRSFDLLFRGLEITSGGQRIHRYEKAKGMDPEAFGFAIGAERLTQKLLGLPNVRYA.............. 410
50 -16.8003w3s_A mol:protein length:527 Type-2 serine--tRNA ligase  ali model follow..  17  130VEDGTVRLTFQDVDEEMLRRHVIDRVIRLVAWAVEERSELVERVTKVEPGTVVDESGPRRIRFRGDVTEEARRLFEVLRDFLLELGFEPALFPKLIPLETMFRMRYELFDDFKRELYVWGEGYVLAPAQCEPFYELLRDEVVDPERPIKLYDCGWTYRWEGKGLERVNEFQRIEHVWIAEPEEARELLEATKRVAEELELEWKVVVSDDPFYLEGRLLEDRDIELPDVPSYEFEVYLPFGRTLFTGCAGLGVTRWVVGLLAQHGFYPYEWPEPILERID... 510
51 -16.6004rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  17  77.RPEGNENPEIPTGQIEVNATELTVLGESAPLPFQLDEQAGEEAR------LKYRYLDLRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTLTRST------------------EGARDFLVPARLQPGSFYAL-KQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMVEADDVIAISEQVLKAVWATIGYD---------------------LPLPLPRISYEEAMRRFGSDKPDLRFGIELVECTEYFKDTT................... 302
52 -16.5004o2d_A mol:protein length:620 Aspartate--tRNA ligase  ali model follow..  17  93.RPEGNENPEIPTGQIEVNATELTVLGESAPLPFQLDEQAGEEAR------LKYRYLDLRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTLTRST------------------EGARDFLVPARLQPGSFYAL-KQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMVEADDVIAISEQVLKAVWATIGYD---------------------LPLPLPRISYEEAMRRFGSDKPDLRFGIELVECTEYFKDTT................... 318
53 -16.4003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  18  186.........AKFLKDNEGKDLTKRPLKDEYAKLLKEKASAQKYVKVSQDTRLDNRMLDLRTVTNIAIFRIQSACCGLFREFLTSQKFVEIHTPKLI-----GCSSEGGSNIFEVKYFDRKAYLAQSPQ--------LYKQMAIMGDFRKVFEVGPVFRAENSNTRHLTEFEGLDIE-MEIVENYHECIDVMEKLFTFIGETYTMPDIDDPNYSNSYDVFVRGQEITSGAQRIHDPEIEKGVDPATLGCGIGLERITMLYLGIPNIRKV.............. 536
54 -15.7001efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model follow..  16  75VRLRPEPNPRLATGRVEVELSALEVLAEAKTPPFPVDAGWRGEEEKEASEELRLKYRYLDLRRRRMQENLRHRVIKAIWDFLDREGFVQVETPFLTKST------------------EGARDFLVPYRHEPGLFYALPQSPQLFKQMLRYFQIARCFRDEDLRADRQPDFTQLDLEM--SFVEVEDVLELNERLMAHV-----------------REALGVELPLPFPRLSYEEAMERYGSDKPDLRFGLELKEVGPLFRQSG................... 310
55 -15.5004ah6_A mol:protein length:617 ASPARTATE--TRNA LIGASE, MITOCHONDRIAL  ali model follow..  17  80..SGTVISRPAGQENPKMPTGEIEIKVELLNACKKLPFEIKNFVKKTEALRLQYRYLDLRSFQMQYNLRLRSQMVMKMREYLCNHGFVDIETPTLF------KRTPGGAKEFLVPSREPGKFYSL-----PQSPQQFKQLLMVGG---RYFQVARCYRDEGSRPDRQPEFTQIDIEM--SFVDQTGIQSLIEGLLQYS-----------------WPNDKDPVVVPFPTMTFAEVLATYGTDKPDTRFGMKIIDISDVFRNTE................... 313
56 -15.4004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  18  134VRKVNQKIGSCTQQDVELHVQKIYVISLAEAVRPEAEGEEEGRATVNQDTRLDNRVIDLRTSTSQAVFRLQSGICHLFRETLINKGFVEIQTPKII-----SAASEGGANVFTVSYFKNNAYLAQSPQ--------LYKQMCICADFEKVFSIGPVFRAEDSNTRHLTEFVGLDIE-MAFNYHYHEVMEEIADTMVQIGVEYTMPDPRNPKQSNSYDMFMRGEEILSGAQRIHDPQLHHGIDLEKIGGGIGLERVTMLFLGLHNVRQT.............. 503
57 -15.4004wj3_M mol:protein length:599 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  18  75..TGKVRLRPEGARNPNMASGSIEVLGEVLNQAETPPFPLDEYSDVGEETRLRYRFIDLRRPEMAAKLKLRARITSSIRRYLDDNGFLDVETPILGRPT------------------EGARDYLVPSRTYPGHFFALPQSPQLFKQLLRYYQIAKCFRDEDLRADRQPEFTQIDIET--SFLDESDIIGITEKMVRQL-------------FKEVLDVEFDEF----PHMPFEEAMRRYGSDKPDLRIPLELVDVADQLKEVE................... 308
58 -15.1001eqr_A mol:protein length:590 ASPARTYL-TRNA SYNTHETASE  ali model follow..  19  72..TGTVRARDEKNINRDMATGEIEVLASSLTIINRADVLPLDSNHVNTEEALKYRYLDLRRPEMAQRLKTRAKITSLVRRFMDDHGFLDIETPMLTKAT------EGARDYLVPSRVHKGKFYAL-----PQSPQLFKQLLM-MSGFDRYYQIVKCFRDEDLRADRQPEFTQIDVET--SFMTAPQVREVMEALVRHL-------------WLEVKGVDLGDF----PVMTFAEAERRYGSDKPDLRNPMELTDVADLLKSVE................... 303
59 -15.0001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  17  105VKKVDEPIKSATVQNLEIHITKIYTISETPESRSEAEAEAAGLPVVNLDTRLDYRVIDLRTVTNQAIFRIQAGVCELFREYLATKKFTEVHTPKLL-----GAPSEGGSSVFEVTYFKGKAYLAQSPQ--------FNKQQLIVADFERVYEIGPVFRAENSNTRHMTEFTGLDME-MAFEEHYHEVLDTLSELFVFIGKEYTMPDPANPKYSNSYDFFMRGEEILSGAQRIHDHAKAHGLSPPHAGGGIGLERVVMFYLDLKNIRRA.............. 478
60 -14.8002cim_A mol:protein length:522 SERYL-TRNA SYNTHETASE  ali model follow..  15  225.......................................................................ARIFRTFEKIVLEEGYREMIFPKLVTWEVWMKSGTHEVPTKLIKEKIAEPIGGMCYAQCPPFWMYVAGETLPNEEPVKVFDRGTSHRYESHGIERVDEFHRIEIVWIGTKEEVLKLHDRYMHIFNDILDIEWRKARVTPWFMAQEGLLGEWLEFQNVSINGDKYPKGFNVKLQ---SGVGLERWAAVQKGLDPANWPEEFRNRVGEMPKGI 513
61 -13.1001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  12  75..EGIVKADERAPGGAEVHVEKLEVIQAVSEFPIPENPEQASPELLLDYRHLHIRTPKASAIM-----KVKETLIMAAREWLLKDGWHEVFPPILVTGA-----VEGGATLFKLKYFDKYAYLSQSAQLYLEAAIFGLE---------KVWSLTPSFRAEKSRRRHLTEFWHLELEAA---MDLWDIMKVEEELVSYM-LKNTEPPFPRISYDEAIDILQSNVEWGDDLGADEERVLTEEFDRPFFVYGYPKHKAFYMKEDPNDPRKVLASDM......... 349
62 -13.0004hwo_A mol:protein length:411 Threonine--tRNA ligase  ali model follow..  20  36.......................................................................RELEVFVRSKLKEYQYQEVKGPFMMDRVLWEKTGHDNYKDAMFTTSSENREYCIKPMNCPGHVQIFNQGLKSYRDPLRMAEFGSCHRNEPSGSLHVRGFTQDDAHIFCTEEQIRDCIRLVYDMYSTFGFEKIVVKLSTRP....................................................................... 185
63 -13.0002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUT  ali model follow..  15  71...GAIKEVPEGKEAPNGHELIADFWKIIGNAPPGGIDNVLNEEASVD--MLDNRHLVIRGENAAALLRLRAAATRAMREHFYNAGYVEVAPPTLVQTQV------EGGSTLFNLDYFGEQ-----SFLTQSSQLYLETCIPTLG---DVFCIAQSYRAEKSRRRHLAEYAHVEAECP---ITLDDLMEKIEELVCDTKFQPPERPFLRMEYKDAIKWLQETFTYGEDIAEAAERFMTDTINKPILLNRFPSEKAFYMQRDAKDNTLTESVDLLMPGV.... 358
64 -12.5002i4l_A mol:protein length:458 Proline-tRNA ligase  ali model follow..  15  62....................................................................RVLKKIEQIVREEQNRAGAIELLMPTLQLADLWRESGDAYGPEMLRIADRHKRELLYGPTNEEMITEIFRAYIKSYKSPLNLYHIQWKFRDERFGVMRGREFLMKDAYSFDVDEAYNKMFVAYLRTFARMGLKAIPMRAETGPIGGDLS................................................................. 221
65 -12.4003a31_A mol:protein length:471 Probable threonyl-tRNA synthetase 1  ali model follow..  13  1.................MASGQDKTHIDYAYELDITVKPDSRVP-VFNREFATFTGAGVPLFSLGGGP-IRYALAEVLAKFHARRGYYVVETPIIASTELFKVSGHEFYRNNMYLFDIEGHEFAVKPMNCPYHILLFLNEVAKHRSPFKVFEFGRVHRYEPSGSIYVRGFTQDDAHIIVPGGRVIEEMKLVLERLFKLGVSSETFKVRLSMSDKSLIG-----------------KEFMGSKEEWEGAEEALREAASEKYGIDIVELEGEAAFYGPKLDFIM 265
66 -12.3003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  13  94YAGKNHPPEIADILNLEMQVTEWKVIGESPIDLENIINKDSSIPQKMQNRHIVIRSEHTQQVL-----QLRSEIQWYFRKYYHDNHFTEIQPPTIVKTQC------EGGSTLFKLQYFNEP-----AYLTQSSQLYLESVIASLG---KSFCMLSSYRAEQSRVRHLAEYLHLEAELP---ISFEDLLNHLEDLVCTVHLKLPTRPFKRMTYADAIKYCNDPFEYGEDISEKPERQMTDEIGCPIFMIHFPSKKAFYMSKVPGHPDLTESVDLLMPGV.... 377
67 -12.0001nyq_A mol:protein length:645 threonyl-tRNA synthetase 1  ali model follow..  16  209......SNNKMLQRIYGTAFFDKKELKAHLQMLEERKERDHRKIKELELFTNSQLVGAGLPLWLPNGATIRREIERYIVDKEVSMGYDHVYTPVLANVDLYKTSGH-QEDMFPPMQLDETESMVLRPMNCPHHMMIYANKPHSYREPIRIAELGTMHRYEASGAVSVRGMTLNDSHIFVRPDQIKEVVNMIIDVYKDFGFEDYSFRLSYRDPEDKEKYFDDDDMWNKAENMLKEAADELGLS........................................ 457
68 -11.8004p3n_A mol:protein length:415 Threonine--tRNA ligase, cytoplasmic  ali model follow..  17  39......................................................................YNALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTSGHQHYSENMFSFEVEKELFALKPMNCPGHCLMFDHRPRSWREPLRLADFGVLHRNELSGATRVRRFQQDDAHIFCAMEQIEDCLDFLRTVYSVFGFSFKLNLSTR......................................................................... 187
69 -11.7004hwt_A mol:protein length:413 Threonine--tRNA ligase, cytoplasmic  ali model follow..  18  35......................................................................YNALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTSGHQHYSENMFSFEVEKELFALKPMNCPGHCLMFDHRPRSWREPLRLADFGVLHRNELSGATRVRRFQQDDAHIFCAMEQIEDCLDFLRTVYSVFGFSFKL.............................................................................. 178
70 -11.6001qf6_A mol:protein length:642 THREONYL-TRNA SYNTHETASE  ali model follow..  15  210......SNNKMLQRIYGTAWADKKALNAYLQRLEEAAKRDHRKIGKQLDLYHMQEEAPGMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRVLWEKTGHDNYKDAMFTTSSENREYCIKPMNCPGHVQIFNQGLKSYRDPLRMAEFGSCHRNEPSGSLHVRGFTQDDAHIFCTEEQIRDCIRLVYDMYSTFGFEKIVVKLSTRP....................................................................... 424
71 -11.3001wle_A mol:protein length:501 Seryl-tRNA synthetase  ali model follow..  19  219.........................................................................LVNFTLNKLIHRGFTPMTVPDLLRGVVFEGCGNAKPSQIYNIDPSRFEDLNLAGTAEVGLAGYFMDHSVAFRDPIRMVCSSTCYRAETDTGKRVHHFTKVEMFGVQSSELLEEFLSLQMEILTELGLHFRVLDMPTQELGLPMPGRGRFGEVTSASNCTDFQSRRLHIMHTVNATGCAVPRLLIA---LESYQQKDGSVLVPPALQ... 459
72 -11.2002j3l_A mol:protein length:572 PROLYL-TRNA SYNTHETASE  ali model follow..  20  48....................................................................RVLEKLKTIMREEFEKIDAVEMLMPALLPAELWKESGETYGPNLYRLKDRNDRDYILGPTHEETFTELIRDEINSYKRPLNLYQIQTKYRDERSGLLRGREFIMKDGYSFSLDQSYRDYEKAYSRIFERCGLEFRAIIGDGGAMG..................................................................... 203
73 -11.1003lsq_A mol:protein length:484 Seryl-tRNA synthetase  ali model follow..  19  214.........................................................................LVSYSLDFLVKRGYTPFYPPFFLNRDVMGEVAQQFDEELYQVSGDGDKKYLIATSEMPIAAYHRGRWFTELKEPLKYAGMSTCFRKEAGAHGRVHQFDKIEQFVVESWRHLEDMITTSEEFNKSLGLPYRVVN............................................................................ 361
74 -10.3003qne_A mol:protein length:485 Seryl-tRNA synthetase, cytoplasmic  ali model follow..  16  191.........................................................................LINYGLSFLSSKGYVPLQAPVMMNKEVMAKTAQQFDEELYKVIDGEDEKYLIATSEQPISAYHAGEWFESPAEPVRYAGYSSCFRREAGSHGRVHAFEKIEQFVLKSWEEFDRMIGCSEEFYQSLGLPYRVV............................................................................. 337
75 -10.2001ser_A mol:protein length:421 PROTEIN (SERYL-TRNA SYNTHETASE (E.C.6.1.1.11)  ali model follow..  14  172.........................................................................LLRFAMDFMARRGFLPMTLPSYAREKAFLGTGHFPAYRDQVWAIAETDLYLTGTAEVVLNALHSGEILPYEALPLRYAGYAPAFRSEAGSFGRVHQFHKVEQYVLASDRAFQELLENAEEILRLLELPYRLV............................................................................. 316

FFAS is supported by the NIH grant R01-GM087218-01
1 2 4 5 2 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Grynberg M, Godzik A. NERD: a DNA processing-related domain present in the anthrax virulence plasmid, pXO1. Trends Biochem Sci. 2004 Mar;29(3):106-10.