current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 3qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280
# Score Template Links and tools%idFirst MKGGLVPRGSHGASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLTPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLVFWQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSALVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNLLast
1 -107.0003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model  100  1MKGGLVPRGSHGASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLTPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLVFWQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSALVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 282
2 -97.5004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  97  6..SGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLGNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPRPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 285
3 -95.1005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  98  3................ALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLAFAQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 268
4 -94.6004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  98  3................ALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLANYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 268
5 -93.4004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  96  2................ALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMVAPNIFNYARKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFFQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCSVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 267
6 -91.3002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  96  5.SSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSGSYYNGISTNL 285
7 -88.8004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  97  5.SSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLSFIQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 285
8 -69.9002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  41  7...GLVPRGSHMFLSSFWTKVQYQRLKELNASGEQLELSRDRAFQGIEHQLMSQGKRHLEQLRTVKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEDHPLFSQVFWLDGKKCLRPMLAPNLYTLWRELERLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPERHQRLEDMARWVLEAAGIEFELVTESSVVYGDTVDVMKGDLELASGAMGPHFLDEKWEIFDPWVGLGFGLERLLMIREGTQHVQSMARSLSYLDGVRLNI 301
9 -47.1004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  12  2............................AMGTLEAQTQGPGSMTEQKRKLEKLTGVKGMNDILPQDAGL-WEFFEATVKSLLRAYGYQNIRTPIVEHTPLFTRGIGEVTDIVEKEMYSNGENLTLRPENTAAVVRAAIEHNMLYDGPKRLWYIGPMFRHERPQRGRYRQFHQVGVEALGFAGPDADAEIVCQRLWEDLGLGIKLEINSLGLAEERAAHRVELIKYLEQHADKLDDDAQRRLTNPLRVLDTKNPALQEIVRNAPKLAHFEGLQRLLKANNVPF 272
10 -46.2002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  13  4............................................YQDPMAKNIQAIRGMNDYLPGETAI-WQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYRNGDSLTLRPEGTAGCVRAGIEHGLLYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDIDAELITARWWRALGIHVTLELNSIGSLEARANYRDALVAFLEQHKEKLDEDCKRRMYNPLRVLDSKNPEVQALLNDAPALEHFAGLCKLLESAGIAY 258
11 -46.0003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  16  2...............................AMGTLEAQTQGPGSMQKNMVETEPVQGCRDFPPEAMRC-RRHLFDVFHATAKTFGFEEYDAPVLESEELYIRKAGEETEQMFNFITKGGHRVALRPEMTPSLARLLLGKGRSLLLPAKWYSIPQCWRYEAITRGRRREHYQWNMDIVGVKSVSAEVELVACWAMRSLGLDVGIKVNSRKVLQTVVEQAGVTSDKFAPVC--VIVDKMEKIPREEVEAQLAVEIAQRVGEEHEAVKELRQFFEQVEAYGYG. 275
12 -45.1003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  14  2...............................AMGTLEAQTQGPGSMQMNMVETEPVQGCRDFPPETMR-LRKYLFDVFHSTARKFGFEEYDSPVLESEELYIRKAGEETEQMFNFITKGGHRVALRPEMTPSLARQLLAKGRSLLLPAKWYSIPQCWRYEAITRGRRREHYQWNMDIIGVKSVSSEVELVACTAMQSLGLDVGVKINSRKILQTVVEQAGVSADKFAPVCVI--VDKMEKLPREEVVAQLAAIGLESIGEEHEAVRELRDFITQIEAYGFG. 275
13 -45.0005e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  13  1...............................................MAMSSIVAIKGFNDVLPTQTAA-WRRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRAIGDATDIVEKEMYTFPESLTLRPEGTAGCVRALVEHNLLRGATPRVWYMGPMFRYEKPQKGRYRQFHQFGVETFGVATPDIDAELITARLWKRMGVDVQLELNTLGETDERTEYRNALVAFLNEHKDALDEDSQRRLTNPLRILDSKIESTQKILENAPKLSHFQQLQDYLTAAGIKF 254
14 -44.1001qe0_A mol:protein length:420 Histidine--tRNA ligase  ali model follow..  15  1...................................................MIKIPRGTQDILPEDSKK-WRYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSTDVVQKEMYKGDRSITLRPEGTAAVVRSYIEHKGNPNQPIKLYYNGPMFRYERKQKGRYRQFNQFGVEAIGAENPSVDAEVLVMHIYQSFGLHLKLVINSVGDMASRKEYNEALVKHFEPVIHEFCSDCQSRLHDPMRILDCKVDRDKEAIKTAPRIAYYEQVKAYLDDLGIPY 249
15 -43.8004rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  17  1................................................GPMTARAVRGTKDLFGKELRM-HQRIVATARKVLEAAGALELVTPIFEETQVFEKGVGAATDIVRKEMFRGGRSLTLRPEGTAAMVRAYLEHGKVWPQPVRLWMAGPMFRAERPQKGRYRQFHQVNYEALGSENPILDAEAVLYECLKELGLRLKVKLSSVGDPEDRARYNAYLREVLSPHREALSEDSKERLENPMRILDSKSERDQALLKELEARAHLKEVERHLERLSVPY 253
16 -43.7004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  15  19..EELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGP--DESKQKFVLKTPKGTRDYSPRQMA-VREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLT---NIKRYHIAKVYRRDNPARGRYREFYQCDFDIAGNFDPMAECLKIMCEILSSLQIDFLVKVNDRRILDGMFAICGVSDSKFRTIC--SSVDKLDKVSWEEVKNEMVGEK............................ 268
17 -42.9003od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  14  2............................................NAMSKPFMFEKPFGMRDTLPEWYKT-KKNICDQMTEEINLWGYDMIETPTLEYYETVGVVSAILDQQLFKLLDQQGNTLVLRPDMTAPIARLVASSLKDRAYPLRLAYQSNVYRAQQNEGGKPAEFEQLGVELIGDGTASADGEVIMIAALKRAGLEFKVAIGHVGYVNALLMDVVGNEQRADRFLYEKNYVGYREHVKSLNLSTIDKSRLMNLLSLRGGRAAIEEARGLIQT..... 239
18 -42.3001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  14  1...............................................MYRLQIEKIRGFRDFYPEDMDV-EKFIFKTAEEAAEAFGFRRIDFPSLEYLDLYRIKSGEELQQTYSFVDKGGREVTLIPEATPSTVRMVTSR-KDLQRPLRWYSFPKVWRYEEPQAGRYREHYQFNADIFGSDSPEADAEVIASSILDRLGLQYEIRINSRKIMEEIIG----GMTSSDPFSVFSIIDRYHKISREEFVDQLRSAGIGITGKSSEEIARMAAVEDLLASYGVK. 255
19 -41.8003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  15  5.............................................AKNDKINFSTPSGFPEFLPSEKR-LELYLLDTIRRVYESYGFTPIETPAVERLEVLQAKGNQGDNIIDKSGDTGSEARALKFDQTVPLAAYIARHLNDLTFPFARYQMDVVFRGERAKDGRFRQFRQCDIDVVGREKLSAQMPAIITEIFEAVNIDFVIRINNRKVLTGFFQSLNISETQIKSCISI--IDNLEKVKLELEKEGINPEQTQKIIDFVKIDGSVDDVLDKLKHLS... 260
20 -41.6004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  16  6............................................FELRRQFVLKTPKGTRDYSPRQMA-VREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLT---NIKRYHIAKVYRRDNPTRGRYREFYQCDFDIAGNFDPMAECLKIMCEILSSLQIDFLVKVNDRRILDGMFAICGVSDSKFRTIC--SSVDKLDKVSWEEVKNEMVGEK............................ 215
21 -40.9001z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  13  1.....................................MRGSGSIEGRMEKINYLLPEESAEMTLNQVKS-LRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGKEKMFQFIKHEGQSITLRYDFTLPLVRLYSQIKD--STSARYSYFGKIFRKEKRHKGRSTENYQIGIELFGESADKSELEILALQVIEQLGLKTVFEIGSAKFFQRLCQLADGSTELLTELLLKKDLSGLNAFIEKNNFSKVTNTKDDVLISSFDQLKEFSEKLSMIKPIIIDL 270
22 -40.9003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  13  1..............................SNAMNGTRSAWGARAWEAVRGFADRPPGMQDGYPDFAKR-RRAVETRLLSFVEDAGYEPVTSGLFEYVDTLLRARSPESRDWIRLFDGGGDAVALRPEMTPSIARMAAPRVAAGRTPIRWCYCERVYRRTSWASGKAAESTQVGIERIGEEASVMDVLRLLHEASAAAGVHHRIVVSHARLVPRLLDALGISASLSRAFL--ACLTSGNYVQFRELWQLHAAKDVDLLANLLT................... 241
23 -36.6006FTT Entity 1(prereleased)  ali follow..  10  4.......................................................PDGVADVLFEDAHK-QEVLRHQLTQQLITHGYQLVSPPMIEFTESLLSGASEDKRQTFKIIDQLTRLMGIRADITPQILRIDAHHGG--DGIARYCYAGDVIHTLPSGLFGSRTPLQLGAEIFGCESIAADIELILFSMINSLDMSLHVDLGHVTIFKRLAELAALSASDTEQLMQLYANKNLPELKQVCQVLPMGAQQDTKIVTAIDELQRLKAHLQVQWQCAVSI 256
24 -36.6005m8h_A mol:protein length:388 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  10  4.......................................................PDGVADVLFEDAHK-QEVLRHQLTQQLITHGYQLVSPPMIEFTESLLSGASEDKRQTFKIIDQLTRLMGIRADITPQILRIDAHHGG--DGIARYCYAGDVIHTLPSGLFGSRTPLQLGAEIFGCESIAADIELILFSMINSLDMSLHVDLGHVTIFKRLAELAALSASDTEQLMQLYANKNLPELKQVCQVLPMGAQQDTKIVTAIDELQRLKAHLQVQWQCAVSI 256
25 -33.5001b70_A mol:protein length:350 PHENYLALANYL-TRNA SYNTHETASE  ali model follow..  16  28.KKGLLTQ-----EMKGLSALPLEERRKRGQELNAIKAALEAALEAREKALEEAALKEALERLFSGGLHPITLMERELVEIFRALGYQAVEGPEVESE--FDALNIPEHHPARDMWDTFEGRLLLRTHTSPMQVRYMVAH----TPPFRIVVPGRVFRFEQTDATHEAVFHQLEGLVVGEGIAMAHLKGAIYELAQALFGPDSKVQPVYFPFVEPGAQFGKWLELGGAGMVHPKVFQAVDAYRERLAFGLGVERLAMLRYGIPDIRYFGGRLKFLEQFKGVL 350
26 -33.2001usy_A mol:protein length:275 ATP PHOSPHORIBOSYLTRANSFERASE REGULATORY SUBUNIT  ali model follow..  12  6.......................................................................FEKVFSFYSKATKKGFSPFFVPALEKAEEPA---------GNFFLDRKGNLFSIREDFTKTVLNHRKRYSP--DSQIKVWYADFVYRYSG---SDLVAEYQLGLEKVPRNSLDDSLEVLIVESASEFFEPVIVEIGHTGVYEDLLKEI----PKDLHEKVLNLIDTKNLAEIEFLSHMKKIDEDSIYRRSPEHLKTMDLPLSVREDLL... 206
27 -32.8002rhq_A mol:protein length:294 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  14  3..............................SSSSGLVPRGSHMGTELMEKLNQQLAEETIDVISIGSKHPLTRTVEEIEDLFLGLGYEIVDGYEVEQD--FEALNLPKSHPARDMQDSITDEILMRTHTSPVQARTMEKRNG--QGPVKIICPGKVYRRDSDDATHSHQFTQIEGLVVDKNIKMSDLKGTLELVAKKLSVEVDVSCFKCKGKGCNVCKHTGWIEILGAGMVHPNVLEMAGFDSN-FAFGMGPDRIAMLKYGIEDIRYFTNDVRFLEQFKA.. 282
28 -32.0003l4g_A mol:protein length:508 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  17  160RKRKLLAEVTLKTYWVSKGSAFSTSISKQETSPEMISSGSWRDRPFKPYNFLAHGVL-----PDSGHLHPLLKVRSQFRQIFLEMGFTEMPTPARDQHDTFSQGGYGSQGYKYNWKLDEARKNLLRTHTTSASARALYRLAQKKPFPVKYFSIDRVFRNETLDATHLAEFHQIEGVVADHGLTLGHLMGVLREFFTKLGITQLRFKPAYNPYTEPSMEVKKWVEVGNSGVFRPEMLLPMGLPENVIAWGLSLERPTMIKYGINNIRELGHKVNLQMVYDSPL 492
29 -30.2005x6c_A mol:protein length:553 O-phosphoserine--tRNA(Cys) ligase  ali model follow..  13  66....TIERLRQAYLRMGFEEMINPVIVDEMEIYKQFGPEAMAVLDRCFYLAGLPRPDVGLGNEKVEIIKNLGIDIDEEKKERLREVLHLYKKGAIDGDDLVFEIAKALNVSEFKDLKPESTTLTLRSHMTSGWFITLSSLIKKRKLPLKLFSIDRCFRREQEDRSHLMSYHSASCVVVGEDVSVDDGKVVAEGLLAQFGFTKFKFKETQTEVYAYHPKLGEWIEVATFGVYSPIALAKYNIDVPVMNLGLGVERLAMIIYGYEDVRAM.............. 354
30 -29.0003g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  18  15.................................................................PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPFETRFVGPGHSQGINLYLMTSPEYHMKRLLAA---------PVFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDRLMNEVDDLLQQVLDCQPAESLSYQQAFQRHLEIDPLSADKTQLREAALFTMGVEPHIGKEKPTFIYHFPASQASLAQISTEDHRVAERFEVYYKGIEL.. 246
31 -28.7003pco_A mol:protein length:327 Phenylalanyl-tRNA synthetase, alpha subunit  ali model follow..  13  32....LGKKGHLTLQMTTLRELPPEERPAAGAVINEAKEQVQQALNARKAELESAALNARLAAETIDGLHPVTRTIDRIESFFGELGFTVATGPEIEDD--FDALNIPGHHPARADHDTFDTTRLLRTQTSGVQIRTMKAQ-----QPPIRIIAPGRVYRNDYDQTHTPMFHQMEGLIVDTNISFTNLKGTLHDFLRNFFEEDLQIRPSYFPFTEPSAEVDKWLEVLGCGMVHPNVLRNVGIDPEGFAFGMGMERLTMLRYGVTDLRSFENDLRFLKQFK... 327
32 -28.5004p71_C mol:protein length:338 Phenylalanine--tRNA ligase alpha subunit  ali model follow..  16  32....LGKKGELTQVMKTLGDLPAEERPKVGALINVAKEKVQDVLNARKTELEGAALAARLAAQLSGGLHPVTRTLERIEQCFSRIGYEVAEGPEVEDD--FEALNIPGHHPARAMHDTFNANMLLRTHTSPVQVRTMESQ----QPPIRIVCPGRVYRCDSDLT-HSPMFHQVEGLLVDEGVSFADLKGTIEEFLRAFSAEVDIQCVICSGNGCRVCKQTGWLEVMGCGMVHPNVLRMSNIDPEGFAFGMGAERLAMLRYGVNDLRLFDNDLRFLGQFR... 338
33 -28.3003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  16  3...........................................SSSSGLVPRGSHMSETASWQPSASIPNRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGPGHSQGMNLWLMTSPEYHMKRLLVA---------PVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPLSADKTQLREVALFTFGVEPNIGKEKPTFVYHFPASQASLAQISTEDHRVAERFEVYYKGIEL.. 259
34 -27.6002du3_A mol:protein length:534 O-phosphoseryl-tRNA synthetase  ali model follow..  13  50..FATIQRLREAYLSIGFSEVVNPLIVEDVHVKKQFGREALAVLDRCFYLATLPKPNVGEKIRQIEAITKREVDSKPLQEIFHRYKKGEIDGDVLDVDDITAVKILDEVFPEFKELKPISSTLTLRSHMTTGWFITLSHIADKLPLPIKLFSIDRCFRREQEDATRLYTYFSASCVLVDEELSVDDGKAVAEALLRQFGTQTEVFAFHPKLVGSSTKYSDGWIEIATFGIYSPTALAEYDIPYPVMNLGLGVERLAMILYGYDDVRKMVYPQIHG....... 353
35 -27.2003a74_A mol:protein length:493 Lysyl-tRNA synthetase  ali model follow..  14  104...KISDLGDIVGVRGTMFKTKVGELSIKVSSYEFLTKEKYHGLKDIEQRYRQRYLDLIMNPESKKTFITRSLIIQSMRRYLDSHGYLEVETPMMHAV-----AGGAAARPFITHHNALDMTLYMRIAIELHLKRLIVG---------KVYEIGRVFRNEGISTRHNPEFTMLELYEAYAD--FRDIMKLTENLIAHI-VDLTPEWRRLHMVDAIKEYVGVDFWRQMSDEEARELAKEHGVEQPTFIYGHPVEISPLAKKNPDDPRFTDRFELFIVGREH.. 412
36 -26.8005eln_A mol:protein length:535 Lysine--tRNA ligase  ali model follow..  16  115..HSEIRRGDVVGFTGFPGKSKRGELSLFSKSVVLLSPTAISGLKDQEVRYRQRYLDLMLNEESRKVFKLRSRAIKYIRNYFDRLGFLEVETPMLNMI-----YGGAAARPFITYHNELETQLYMRIAPELYLKQLIVG---------KVYEIGKNFRNEGIDLTHNPEFTAMEFYMAYAD--YYDLMDLTEELISGLGEKLKRPLDSQENIDFMVEMCEKEIELPHPRTAAKLLDKLAGCTNPSFIIDHPQTMSPLAKWHREKPEMTERFELFVLGKEL.. 435
37 -26.7005hgq_A mol:protein length:524 Lysine--tRNA ligase  ali model follow..  14  107..HDRIKRGDIIGVNGYPARSKSGELSIIPYEIIQLTPHTHFGLKNQETRYRMRYLDLIMNPDVKNRFVTRSRMISFLRRYLDNLGFLEVETPMMNLI-----AGGATAKPFITHHNDLDMDLYLRVAPELYLKMLVVG---------RVYEIGRVFRNEGIDQTHNPEFTSCEFYMAYAD--YEDLMKITEDMLARM-VDFTPPFRKVNIYDGLQEKLGIQFPPADTLDTDEANKFFDKL-SPTFLTGHPQIMSPLAKWHRSIPGLTERFELFVVTKEI.. 430
38 -26.7001e1o_A mol:protein length:504 LYSYL-TRNA SYNTHETASE, HEAT INDUCIBLE  ali model follow..  14  112..FKKWDLGDIIGARGTLFKTQTGELSIHCTELRLLTKDKFHGLQDQEVRYRQRYLDLIANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVI-----PGGASARPFITHHNALDLDMYLRIAPELYLKRLVVG---------RVFEINRNFRNEGISVRHNPEFTMMELYMAYAD--YHDLIELTESLFRTLPETDMADLDNFDAAKALAESIG--ITVEKSWGLGRIVTEIFDLIQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREI.. 422
39 -26.6006aqh_A mol:protein length:508 Lysine--tRNA ligase  ali model follow..  16  111..KTYVDIGDIVFVHGEVITSKRGELSVLADSWQMAAKAVAHKEMSEESRVRQRYVDLIVRDQARKVARQRIAVMRAIRSALERRGFLEVETPMLQTL-----AGGAAARPFVTHSNALDTELYLRIAPELFLKRCLVG---------RVFELNRVFRNEGADSTHSPEFVMLETYQAYGT--YDDSAVVTRELIQEVAYDLDGEWESIQMYPSLSEALGEEITPDTPAETLWAIADRLGLDAPTFVKDFPVETTPLTRSHRSIPGVTEKWDLYVRRIEL.. 422
40 -26.5005vl1_A mol:protein length:506 Lysine--tRNA ligase  ali model follow..  15  108..KADVDIGDVVYVHGTVISSRRGELSVLADSWRMAAKAVAHKEMSEESRVRQRYVDLIVRPQAREVARQRIAVIRAVRNALERRGFLEVETPMLQTL-----AGGAAARPFVTHSNALDIDLYLRIAPELFLKRCIVG---------RVFELNRVFRNEGSDSTHSPEFSMLETYQTYGT--YDDSALITRELIQEVAYDIDGEWATMEMYSSLSEALGEQITPETTVARLRDIASGLDVEAPTFVKDFPVETTPLTRQHRSIPGVTEKWDLYVRGVEL.. 418
41 -26.5001bbu_A mol:protein length:504 PROTEIN (LYSYL-TRNA SYNTHETASE)  ali model follow..  14  112..FKKWDLGDILGAKGKLFKTKTGELSIHCTELRLLTKDKFHGLQDQEARYRQRYLDLISNDESRNTFKVRSQILSGIRQFMVNRGFMEVETPMMQVI-----PGGAAARPFITHHNALDLDMYLRIAPELYLKRLVVG---------RVFEINRNFRNEGISVRHNPEFTMMELYMAYAD--YKDLIELTESLFRTLPETDMADLDNFDSAKAIAESIG--IHVEKSWGLGRIVTEIFELIQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREI.. 422
42 -26.5003bju_A mol:protein length:521 Lysyl-tRNA synthetase  ali model follow..  17  106...NKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPHLHFGLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNII-----PGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVG---------RVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYAD--YHDLMEITEKMVSGM.................................................................................... 293
43 -26.3004ycv_A mol:protein length:516 Lysine--tRNA ligase  ali model follow..  18  107...DKIRRGDIVGIVGFPGKSKKGELSIFPKETILLSACMKYGLKDTEIRYRQRYLDLLINESSRHTFVTRTKIINFLRNFLNERGFFEVETPMMNLI-----AGGANARPFITHHNDLDLDLYLRIATELPLKMLIVG---------KVYEIGKVFRNEGIDNTHNPEFTSCEFYWAYAD--YNDLIKWSEDFFSQLNTILEQPFDSNETIEKMINIIKEKIELPNPPTAAKLLDQLASNDKPFFIVEHPQIMSPLAKYHRTKPGLTERLEMFICGKEV.. 426
44 -26.0004ex5_A mol:protein length:529 Lysine--tRNA ligase  ali model follow..  14  128...KKWDLGDIVAARGVLFRTNKGELSVKCTQLRLLAKDKFHGLADQETRYRQRYVDLIVTPETRTTFRARTKAIASIRKFMGDADFMEVETPMLHPI-----PGGAAAKPFVTHHNALDMEMFLRIAPELYLKRLIVG---------RVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTD--YRWLMDFTERLIRQAPSYTDGQLSDDAFLRSELKRLGVDVTQGALQLALFEETAEAQLWEPTFIIDYPIEVSPLARESDTVAGITERFELFITGREI.. 441
45 -25.4003ig2_A mol:protein length:213 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  18  7.......................................................................NKLQNLVAEQLVGCGFNEILNNSLTRAAYYDGLESYPSKNLVMLLNPLSADLCMRQTLLFGGLESIAHNANRKNADLKFFEFGNCYHFDAEKKNPYSEDYHLGLWVTGKMVSNSELKAYVENIFKRLGLDLHSLVVGNLS-TALTVNTKGGKRLATFGVVTKKMLKAFDVDNEVYYADLNWKELM.......................... 213
46 -25.2006chd_A mol:protein length:597 Lysine--tRNA ligase  ali model follow..  14  173..NNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPHLHFGLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNII-----PGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVG---------RVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYAD--YHDLMEITEKMVSGM-VDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDI-NPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEI.. 495
47 -25.1003ica_A mol:protein length:213 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  18  6......................................................................RYKWQTVVSEQLVGAGFNEILNNSLTAGSYYEGLKSHPREMAVELMNPLSQELCMRQTLLFGGLETLSHNLRRKHLSLYLFEWGKCYRFHAAKRTDYAEDDRLGIWICGQRVHNSELKAVVEQVLCRVGIETGAYTLKTA--SAMEVKTRSGKLLGTFGTVSTELIKRFEIEQPVYFAELLWDAL........................... 212
48 -24.5004up7_A mol:protein length:777 LYSINE--TRNA LIGASE  ali model follow..  17  105....MIYRGDICGFTGHPTRTKTGELSLIPISGMILSPSMHYGLGDQETRFRKRYLDLIVNPESVKNFVLRTKVVKAVRKYLDDKGFLEVETPILNT-----IPGGATARPFITHHNQLDIQMYMRIAPELYLKELVVG---------RVYEIGRLFRNEGIDQTHNPEFTTCEFYMAYAD--YNDIMKMTEELLGNM.................................................................................... 291
49 -23.1001efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model follow..  16  69....VRAKGLVRLRPEPNPRLATGRVEVELSALEVLAEAKEEEKEASEELRLKYRYLDLRRRRMQENLRLRHRVIKAIWDFLDREGFVQVETPFL-----TKSTPEGARDFLVPYRHEPGLFYALP--QSPQLFKQML----MVAGLDRYFQIARCFRDEDLRADRQPDFTQLDLEMSFVE--VEDVLELNERLMAHV.................................................................................... 261
50 -21.9004wj3_M mol:protein length:599 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  19  75..TGKVRLRPEGARNPNMA---SGSIEVLGYELEVLNQAETPPFPLDEYSDVGEETRDLRRPEMAAKLKLRARITSSIRRYLDDNGFLDVETPIL-----GRPTPEGARDYLVPSRTYPGHFFALP--QSPQLFKQLL----MVAGFDRYYQIAKCFRDEDLRADRQPEFTQIDIETSFLD--ESDIIGITEKMVRQL.................................................................................... 260
51 -21.7004rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  17  69...AVTGVVEVRPEGNENPEIPTGQIEVNATELTVLGESAPLPFQLDEQAGEEARLKDLRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTL-----TRSTPEGARDFLVPARLQPGSFYALP--QSPQLFKQLL----MVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVE--ADDVIAISEQVLKAV.................................................................................... 254
52 -21.4004h2w_A mol:protein length:346 Amino acid--[acyl-carrier-protein] ligase 1  ali model follow..  17  4.............SSSGLVPRGSHMNIAVLPNSPDTAPQIADPLDHLADKLFHSMGSDGVYARTALYESIVERLAALITS-HREAGTEALRFPPVMSRAQLEKSGSRFDAGGDWTTSLSPADLVLSPAACYPVYPIAASRGPLPKGGLRFDVAADCFRRESKHLDRLQSFRMREYVCIGTPDDRERWMVRAQAIARDLGLTFRVDYASDPFFGRAGKMLEQPTACMSFNYHREHFGTTWGIQDA---VAFGMDRLAVAM....................... 305
53 -21.3004o2d_A mol:protein length:620 Aspartate--tRNA ligase  ali model follow..  17  86....VTGVVEVRPEGNENPEIPTGQIEVNATELTVLGESAPLPFQLDEQAGEEARLKDLRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTL-----TRSTPEGARDFLVPARLQPGSFYALP--QSPQLFKQLL----MVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVE--ADDVIAISEQVLKAV.................................................................................... 270
54 -21.3002i4l_A mol:protein length:458 Proline-tRNA ligase  ali model follow..  14  6..SGLVPRGSHMRLSRFFLPILKENPKEAEIVSHRLM---------LRAGMLRQEAAGIYAWLPLGHR-VLKKIEQIVREEQNRAGAIELLMPTLQLADLWRESGDAYGPEMLRIADRHKRELLYGPTNEEMITEIFRAYIKSYKSPLNLYHIQWKFRDEQRPRFRGREFLMKDAYSFDVDEAGARMFVAYLRTFARMGLKAIPMRAETGPIGGDLS................................................................. 221
55 -21.2003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein  ali model follow..  21  6..........................................................IISRDIYKAIDIQTKILDYMTKFFTDRGFKWLLPIMLSPITDPLWPDPAGEGIRPAEVDVYGVRMRLTHSMILHKQLAIAMGLE------KIFVLSPNIRLESRRKRHSYEFTQLDFEIEGAK--MKDVMRLIEELIYGL--EFYDREENGVWKNYDLILPYGYGEVSSGGEREWEYEKRAGKLKPSAGAGIGVERLVRFIVGAKHIAEV.............. 281
56 -21.1005w25_A mol:protein length:616 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  19  90..AGVVEIRPEGNAN---PEIATGEIEVNATSLTVLGECAPLPFQLDEPAGEELRLKDLRRDDPAAAIRLRSRVNAAARAVLARHDFVEIETPTI-----TRSTPEGARDFLVPARLHPGSFYALPQ--SPQLFKQLL----MVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVD--AEDIIAISEEVLTEL.................................................................................... 273
57 -20.7003mey_A mol:protein length:346 Bll0957 protein  ali model follow..  18  3............SSSSGLVPRGSHMNIAVLPNSPDTAPQIADPLDHLADKLFHSMGSDGVYARTALYESIVERLAALITS-HREAGTEALRFPPVMSRAQLEKSGHGTEREINAAVSRFDADLVLSPAACYPVYPIAASRGPLPKGGLRFDVAADCFRRESKHLDRLQSFRMREYVCIGTPDDRERWMVRAQAIARDLGLTFRVDYASDPFFGRVLRSEEQPTACMSFNYHREHFGTTWGIQDA---VAFGMDRLAVAM....................... 305
58 -20.6001eqr_A mol:protein length:590 ASPARTYL-TRNA SYNTHETASE  ali model follow..  20  72..TGTVRARDEKNINRDM---ATGEIEVLASSLTIINRADVLPLDSNHVNTEEARLKDLRRPEMAQRLKTRAKITSLVRRFMDDHGFLDIETPML-----TKATPEGARDYLVPSRVHKGKFYALP--QSPQLFKQLL----MMSGFDRYYQIVKCFRDEDLRADRQPEFTQIDVETSFMT--APQVREVMEALVRHL.................................................................................... 255
59 -20.3005xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  17  100..YGMLNLTPKGKQAPGGHELSCDFWELIGLAPAGGADNLINEESDVDVQLNNRHMM-IRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQ-----VEGGATLFKLDYFGEEAFLTQSSQLYLETCLPALG---------DVFCIAQSYRAEQSRRRHLAEYTHVEAECPFLT--FDDLLNRLEDLVCDV.................................................................................... 279
60 -20.1001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  18  6..........................................................IISREISPTLDIQTKILEYMTDFFVKEGFKWLLPVIISPITDPLWPDPAGEGMEPAEVEIYGVKMRLTHSMILHKQLAIAMGLK------KIFVLSPNIRLESRQKRHAYEFTQLDFEVAKMEDIMRLIERLVYGLFRKAEEWTGREFPEVFEYSEVLEEFGSDEEVASGGEREWEYEKKAGKLKPSAGAGIGVERLVRFIVGAKHIAEVQPFPRIPGIPAV.. 293
61 -19.6002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  16  70..YGAIKEVPEGKEAPNGHELIADFWKIIGNAPPGGIDNVLNEEASVDKMLDNRHLV-IRGENAAALLRLRAAATRAMREHFYNAGYVEVAPPTLVQTQ-----VEGGSTLFNLDYFGEQSFLTQSSQLYLETCIPTLG---------DVFCIAQSYRAEKSTRRHLAEYAHVEAECPFIT--LDDLMEKIEELVCDT.................................................................................... 249
62 -19.5003l4g_B mol:protein length:589 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  12  319...GIRETPENLAKLLTRMYLKSEVIGDGNQIEIEIPPTRADIIHACDIVEDAAIAYGYNNIQMTANQFPLNKLTELLRHDMAAAGFTEALTFALCSQEDIADKLGSATKAVHISNPKTAEFQVARTTLLPGLLKTIAANRKM-PLPLKLFEISDIVIKDSNTDVGAKNYRHLCAVYYNKNPGFEIIHGLLDRIMQLLDVPPGEDKGGYVI-GRCAEIFARGQSVGKLGVLHPDVITKFELTMPCSSLEINIGPF........................... 588
63 -19.4002j3l_A mol:protein length:572 PROLYL-TRNA SYNTHETASE  ali model follow..  16  1...............MKQSKMLIPTLREVPNDAEVLSHQ-------LRAGYIRQVAAGIYSYLPLANR-VLEKLKTIMREEFEKIDAVEMLMPALLPAELWKESGETYGPNLYRLKDRNDRDYILGPTHEETFTELIRDEINSYKRPLNLYQIQTKYRDEKRSRSRGREFIMKDGYSFHADQSYRDYEKAYSRIFERCGLEFRAIIGDGGAMGGKDSK................................................................ 208
64 -19.3004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  16  150.........ELHVQKIYVISLAEPRLPLQLDDAVRPEAEGEEEGRATVNQDTRLDNRDLRTSTSQAVFRLQSGICHLFRETLINKGFVEIQTPKIISAA-----SEGGANVFTVSYFKNNAYLAQSPQLYKQMCIC------------KVFSIGPVFRAEDSNHRHLTEFVGLDIEMAFNYH-YHEVMEEIADTMVQI.................................................................................... 327
65 -19.0004ah6_A mol:protein length:617 ASPARTATE--TRNA LIGASE, MITOCHONDRIAL  ali model follow..  16  80..SGTVISRPAGQEN---PKMPTGEIEIKVKTAELLNACKKLPFEIKNFVKKTEALRDLRSFQMQYNLRLRSQMVMKMREYLCNLGFVDIETPTL------FKRTPGGAKEFLVPSREPGKFYSLP--QSPQQFKQLL----MVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVD--QTGIQSLIEGLLQYS.................................................................................... 265
66 -18.9001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  15  75..EGIVKADERAPGGAEVHVEKLEVIQAVSEFPIPENPEQASPELLLDYRHLHIRTPKASAIM-----KVKETLIMAAREWLLKDGWHEVFPPILVT-------GAVEGGATLFKLKYFDKYAYLSQSAQLYLEAAIFGLE-------KVWSLTPSFRAEKSRTRHLTEFWHLELEAAWMD--LWDIMKVEEELVSYM.................................................................................... 250
67 -18.7001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  12  121.........EIHITKIYTISETPEALPILLEDASRSEAEAEAAGLPVVNLDTRLDYRDLRTVTNQAIFRIQAGVCELFREYLATKKFTEVHTPKLLGAP------SEGGSSVFE-VTYFKGKAYLAQSPQFNKQQLIVA---------RVYEIGPVFRAENSNTRHMTEFTGLDMEMAFEEH-YHEVLDTLSELFVFI.................................................................................... 298
68 -18.6001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  17  75..EGVVNFTPKAKLGFEI---LPEKIVVLNRAETPLPLDPTGKVKAELDTRLNNRFMDLRRPEVMAIFKIRSSVFKAVRDFFHENGFIEIHTPKIIATA-----TEGGTELFPMKYFEEDAFLAESPQLYKEIMMA------------RVYEIAPIFRAEEHNTRHLNEAWSIDSEMAFIED-EEEVMSFLERLVAHA.................................................................................... 254
69 -18.6005ucm_A mol:protein length:579 Proline--tRNA ligase  ali model follow..  19  1.............MAMRTSQYLLSTLKETPADAVVISHQ-------LRAGMIRRLASGLYTWLPMGLR-VLRKVETIVREEMNAAGALEVLMPAVQPAELWQESGEQYGPELLRLKDRHEREFCVGPTHEEVITDLARNELNSYKQPINFYQIQTKFRDEIRPRFRGREFIMKDAYSFHLSQTYDGMYQAYSKIFSRLGLDFRPVQADNGSIGGSGSH................................................................ 210
70 -18.6003cmq_A mol:protein length:415 Phenylalanyl-tRNA synthetase, mitochondrial  ali model follow..  13  1..............MAAECATQRAPGSVVELLGKSYPQDDHSNLTRKVLTRVGRNLH-------NQQHHPLWLIKERVKEHFYKQYVGRFGTPLFSVYDNLSPVVTTWQNPADHPSRKKGDNYYLNRTHMLRAHTSAHQWDLLHAGLDAFLVVGDVYRRDQIDSQHYPIFHQLEAVRLAVKLVEFDLKQTLTRLMAHLFGDELEIVDCYFPFTHPINFHGEWLEVLGCGVMEQQLVNSAGAQDRIWAFGLGLERLAMILYDIPDIRLFWCEDERF....... 303
71 -18.6001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  19  72..RGIVKADKRAPRGIEL---HAEEITLLSKAKAPLPLDVSGKVKADIDTRLRERVLDLRRQEMQAVIKIQSLALKAFRETLYKEGFIEIFTPKIIASAT------EGGAQLFPVIY-FGKEAFLA--QSPQLYKELMAGVVE-----RVFEVAPAWRAEESDTFHLAEFISMDVEMAFAD--YNDVMQLLEKILHNI.................................................................................... 249
72 -18.6003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  13  88..TGRLNAYAGKNHPPEIADILNLEMQKVIGESPIDLENIINKDSSIPQKMQNRHIV-IRSEHTQQVLQLRSEIQWYFRKYYHDNHFTEIQPPTIVKTQ-----CEGGSTLFKLQYFNEPAYLTQSSQLYLESVIASLG---------KSFCMLSSYRAEQSRTRHLAEYLHLEAELPFIS--FEDLLNHLEDLVCTV.................................................................................... 271
73 -18.4004k86_A mol:protein length:535 Proline--tRNA ligase  ali model follow..  4......SSSGLVPRGSHMASGAGEGQGPKKQTRLGLEAKKEENLADWYSQVITKSISGCYILRPWAYA-IWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKVADFAPEVAWVTRLAEPIAIRPTSETVMYPAYAKWVQSHRDPIKLNQWCNVVRWEFKHP-RTREFLWQEGHSAEAAEEVLQILDLYAQVYEELLAIPVVK............................................................................. 224
74 -18.0001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  18  62..RGLVVENAKAPGGLEVQAKEVEVLSPALEPTPVEIPKEEWRAN--PDTLLEYRYVTLRGEKARAPLKVQAALVRGFRRYLDRQDFTEIFTPKVVR-------AGAEGGSGLFGVDYFEKRAYLA--QSPQLYKQIMVGVFE-----RVYEVAPVWRMEEHTSRHLNEYLSLDVEMGFIAD-EEDLMRLEEALLAEM.................................................................................... 241
75 -17.8003ial_A mol:protein length:518 Prolyl-tRNA synthetase  ali model follow..  15  1..................MAMGGDVTFSLTKTRDTFADWFDAIMDAAELVDRRYPVKGCVVFRPYGFF-MENAIMRLCEEEYAKVGISQILFPTVIPESFLKKESDECFWVEKGGLQPLEERLALRPTSETAIYSMFSKWVRSYKDPLKIHQTCTIFRHETKNT-RVREIHWNEAHCCHATA--EDAVSQLSDYWKVI.................................................................................... 188

FFAS is supported by the NIH grant R01-GM087218-01
1 2 5 9 6 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24