current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 4bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .
# Score Template Links and tools%idFirst MGSSSSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLGNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPRPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNLLast
1 -133.0004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model  100  1MGSSSSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLGNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPRPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 285
2 -123.0004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  97  1..................PALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMVAPNIFNYARKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFFQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCSVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 267
3 -122.0004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  98  1MGSSSSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLSFIQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 285
4 -121.0002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  98  1MGSSSSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSGSYYNGISTNL 285
5 -116.0004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  99  2..................PALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLANYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 268
6 -115.0003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  96  2....KGGLVPRGSHGASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLTPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLVFWQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSALVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 282
7 -79.7002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  39  1MGSRGSHMFLTRRDPPLSSFWTKVQYQRLKELNASGESDALSRDRAFQGIEHQLMSQGKRHLEQLRTVKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEDHPLFSQVFWLDGKKCLRPMLAPNLYTLWRELERLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEHQRLEDMARWVLEAAGIEFELVTESSVVYGDTVDVMKGDLELASGAMGPHFLDEKWEIFDPWVGLGFGLERLLMIREGTQHVQSMARSLSYLDGVRLNI 301
8 -53.7001b70_A mol:protein length:350 PHENYLALANYL-TRNA SYNTHETASE  ali model follow..  14  26LGKKGLLTQEMKGLSALPLEERRKRGQELNAIKAALEAALEAREKALEEAALKE-ALERERVDVSLPGGGLHPITLMERELVEIFRALGYQAVEGPEVESEFFFDALNIPEHHPARDMWDEVEGRLLLRTHTSPMQVRYMVAH----TPPFRIVVPGRVFRFEQTDATHEAVFHQLEGLVVGEGIAMAHLKGAIYELAQALFGPKVRFQPVYFPFVEPGAQFAKWLELGGAGMVHPKVFQAVDAYREGFAFGLGVERLAMLRYGIPDIRYFFGGRLFLEQFKGVL 350
9 -51.7003pco_A mol:protein length:327 Phenylalanyl-tRNA synthetase, alpha subunit  ali model follow..  13  32LGKKGHLTLQMTTLRELPPEERPAAGAVINEAKEQVQQALNARKAELESAALNA-RLAAETIDVSLPGGGLHPVTRTIDRIESFFGELGFTVATGPEIEDDYHFDALNIPGHHPARADTFWFDTTRLLRTQTSGVQIRTMKAQ----QPPIRIIAPGRVYRNDY-DQTHTPMFHQMEGLIVDTNISFTNLKGTLHDFLRNFFEEQIRFRPSYFPFTEPSAEVDKWLEVLGCGMVHPNVLRNVGIDPEGFAFGMGMERLTMLRYGVTDLRSFFENDLFLKQFK... 327
10 -50.2004p71_C mol:protein length:338 Phenylalanine--tRNA ligase alpha subunit  ali model follow..  14  32LGKKGELTQVMKTLGDLPAEERPKVGALINVAKEKVQDVLNARKTELEGAALAA-RLAAERIDVTLPGGGLHPVTRTLERIEQCFSRIGYEVAEGPEVEDDYHFEALNIPGHHPARADTFYFNANMLLRTHTSPVQVRTMESQ----QPPIRIVCPGRVYRCDS-DLTHSPMFHQVEGLLVDEGVSFADLKGTIEEFLRAFFEKEVRFRPSFFPFTEPSAEVDGWLEVMGCGMVHPNVLRMSNIDPEGFAFGMGAERLAMLRYGVNDLRLFFDNDLFLGQFR... 338
11 -47.9002rhq_A mol:protein length:294 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  14  1.............MGSSSSGLVPRGSHMGTELMEKLNQ-----------------QLAEETIDVTLPSGSKHPLTRTVEEIEDLFLGLGYEIVDGYEVEQDYYFEALNLPKSHPARDDSFYITDEILMRTHTSPVQARTMEK--RNGQGPVKIICPGKVYRRDSDDATHSHQFTQIEGLVVDKNIKMSDLKGTLELVAKKLFGAEIRLRPSYFPFTEPSVEVDGWIEILGAGMVHPNVLEMAGFDSNGFAFGMGPDRIAMLKYGIEDIRYFYTNDVFLEQFK... 281
12 -47.8003l4g_A mol:protein length:508 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  17  169........TLKTYWVSKGSAFSTSISKQETELSPEMISSGSWRDRPFKPYNFLAHGVLPDS-------GHLHPLLKVRSQFRQIFLEMGFTEMPTALFQPQQHPARDQHDT----YNWKLDEARKNLLRTHTTSASARALYRLAQKKPTPVKYFSIDRVFRNETLDATHLAEFHQIEGVVADHGLTLGHLMGVLREFFTKLGITQLRFKPAYNPYTEPSQGLKKWVEVGNSGVFRPEMLLPMGLPESVIAWGLSLERPTMIKYGINNIRELVGHKVNLQMVYDS. 490
13 -44.6002du3_A mol:protein length:534 O-phosphoseryl-tRNA synthetase  ali model follow..  14  1...............................MKFDPQKYRELAEKDFEAAWKAGKEIAERSPNELYPRGKEHPLFATIQRLREAYLSIGFSEVVNPLIVEDVHVKKQFGREALAVLDRCFYISSTLTLRSHMTTGWFITLSHIADKLPLPIKLFSIDRCFRREQEDATRLYTYFSASCVLVDEELSVDDGKAVAEALLRQFGFENFRFREKRSKYYIPDTQTEGWIEIATFGIYSPTALAEYDIPYPVMNLGLGVERLAMILYGYDDVRKMVYPQIHGEIKLSDL 360
14 -43.7002du7_A mol:protein length:549 O-phosphoseryl-tRNA synthetase  ali model follow..  15  2......................KLKHKRDDKMRFDIKKVLELAEKDFETARETRALIKDKHIDNKYPRGKPHPVMETIERLRQAYLRMGFEEMINPVIVDEMEIYKQFGPEAMAVLDRCFYLATTLTLRSHMTSGWFITLSSLIKKRKLPLKLFSIDRCFRREQRDRSHLMSYHSASCVVVGEDVSVDDGKVVAEGLLAQFGFTKFKFKPKKSKYYTPETQTEEWIEVATFGVYSPIALAKYNIDVPVMNLGLGVERLAMIIYGYEDVRAMVYPQFYEYRLS... 361
15 -34.6001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  15  2...................................................YRLQIEKIRGFRDFYPEDMDV-EKFIFKTAEEAAEAFGFRRIDFPSLEYLDLYRKSGEELLQQTYSFVDKGGREVTLIPEATPSTVRMVTSR-KDLQRPLRWYSFPKVWRYEEPQAGRYREHYQFNADIFGSDSPEADAEALASSILDRLGLQYEIRINSRKIMEEIIGGMTSSDPFS-SIIDRYHKISREEFVDQLRSAGIGEDGVSMI........................ 215
16 -32.5003cmq_A mol:protein length:415 Phenylalanyl-tRNA synthetase, mitochondrial  ali model follow..  14  2.......................AAECATQRAPGSVVELLGKSYPQDDHSNLTRKVLTRVGRN--LHNQQHHPLWLIKERVKEHFYKQYVGRFGTPLFSTWQNFDSLLIPADHPSRKDNYYLNRTHMLRAHTSAHQWDLLHA------GLDAFLVVGDVYRRDQIDSQHYPIFHQLEAVRLAVKLVEFDLKQTLTRLMAHLFGDELEIRDCYFPFTHPSFEMEEWLEVLGCGVMEQQLVNSAGAQDRGWAFGLGLERLAMILYDIPDIRLFWCEDEFLKQFCVS. 310
17 -31.5001z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subu  ali model follow..  12  4...........................................SGSIEGRMEKINYLLPEESAEMTLNQVKS-LRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGQEKMFQFIKHEGQSITLRYDFTLPLVRLYSQIKD--STSARYSYFGKIFRKEKRHKGRSTENYQIGIELFGESADKSELESLALQVIEQLGLNKTVFE............................................................................ 172
18 -31.4003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  16  2..................................AMGTLEAQTQGPGSMQKNMVETEPVQGCRDFPPEAMR--RRHLFDVFHATAKTFGFEEYDAPVLESEELYRKAGEEITEQMFNFITKGGHRVALRPEMTPSLARLLLGKGRSLLLPAKWYSIPQCWRYEAITRGRRREHYQWNMDIVGVKSVSAEVECAACWAMRSLGLDVGIKVNSRKVLQTVVEQAGVTSDKFAPIVDKMEKIPREEVEAQLAVLGLEPTVVDAI........................ 236
19 -31.2003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  16  5.....................................TLEAQTQGPGSMQMNMVETEPVQGCRDFPPETMR--RKYLFDVFHSTARKFGFEEYDSPVLESEELYRKAGEEITEQMFNFITKGGHRVALRPEMTPSLARQLLAKGRSLLLPAKWYSIPQCWRYEAITRGRRREHYQWNMDIIGVKSVSSEVECAACTAMQSLGLDVGVKINSRKILQTVVEQAGVSADKFAPIVDKMEKLPREEVVAQLAAIGLESNVVDAI........................ 236
20 -28.2004rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  19  2....................................................PMTARAVRGTKDLFGKELRMH-QRIVATARKVLEAAGALELVTPIFEETQVFEKGVGAATDIVRKEMFRGGRSLTLRPEGTAAMVRYLEHGMKVWPQPVRLWMAGPMFRAERPQKGRYRQFHQVNYEALGSENPILDAEVLLYECLKELGLRRLKVK-VRTAFEVHHEEIGAQSALGGGGRYDGLSELLGGPRVPGVGFAFGVERVALA........................ 317
21 -28.1001qe0_A mol:protein length:420 HISTIDYL-TRNA SYNTHETASE  ali model follow..  17  1......................................................MIKIPRGTQDILPEDSKKW-RYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSTDVVQKEMYKGDRSITLRPEGTAAVVRSYHKMQGNPNQPIKLYYNGPMFRYERKQKGRYRQFNQFGVEAIGAENPSVDAEAMVMHIYQSFGLKHLKLHTAFELMMDNPNYDGAITTLCGGGRYNGLLELLDGPSETGIGFALSIERLLLALEEEG................... 321
22 -27.4004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  14  18...............................................EQKRKLEKLTGVKGMNDILPQDAGLW-EFFEATVKSLLRAYGYQNIRTPIVEHTPLFTRGIGEVTDIVEKEMYSNGENLTLRPENTAAVVRAAIEHNMLYDGPKRLWYIGPMFRHERPQRGRYRQFHQVGVEALGFAGPDADAEMMCQRLWEDLGLTGIKLE-NLTVFEWVTDKLGAQGTVAAGGRYDPLIEQLGGKPTAACGWAMGIERILELLKEEHLVPEQEGVDVYV....... 353
23 -25.7003od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subu  ali model follow..  14  2...............................................NAMSKPFMFEKPFGMRDTLPEWYKT-KKNICDQMTEEINLWGYDMIETPTLEYYETVGVVSAILDQQLFKLLDQQGNTLVLRPDMTAPIARLVASSLKDRAYPLRLAYQSNVYRAQQNEGGKPAEFEQLGVELIGDGTASADGEALMIAALKRAGLEFKVAIGHVGYVNALLMDVVGNEQRADRLVGYREHVKSLNLSTIDKSRLMNLLSLRGGRAAIEEARGLIQTEKGKTALA... 247
24 -25.7002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  16  4...............................................YQDPMAKNIQAIRGMNDYLPGETAIW-QRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYRNGDSLTLRPEGTAGCVRAGIEHGLLYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDIDAEMLTARWWRALGISEHVTLENRTVFEWVTNSLGSQGTVCAGGRYDGLVEQLGGRATPAVGFAMGLERLVLLVQAVN................... 327
25 -25.3003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  15  18..................................................AVRGFADRPPGMQDGYPDFAKR-RRAVETRLLSFVEDAGYEPVTSGLFEYVDTLLRRSPESSRDWIRLFDGGGDAVALRPEMTPSIARMAAPRVAAGRTPIRWCYCERVYRRTDDPSGKAAESTQVGIERIGEEASVMDVLRLLHEASAAAGVRHHR------------------IVVSHARLVP-RLLDALGISAS...................................... 204
26 -25.0005e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  16  7........................................................VAIKGFNDVLPTQTAAW-RRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRAIGDATDIVEKEMYTPPESLTLRPEGTAGCVRALVEHNLLRGATPRVWYMGPMFRYEKPQKGRYRQFHQFGVETFGVATPDIDAEMLTARLWKRMGVDHMVQLENKTVFEWTTTALGSQGTVCAGGRYDGLVGQLKG-SVPAVGFAMGMERLLLLLEQVEQAEIVRDCEAFL....... 338
27 -24.2003ig2_A mol:protein length:213 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  17  8...........................................................................KLQNLVAEQLVGCGFNEILNNSLTRAAYYDGLESYPSKNLVMLLNPLSADLCMRQTLLFGGLESIAHNANRKNADLKFFEFGNCYHFDAEKKNPYSEDYHLGLWVTGKMVSNSELKAYVENIFKRLGLDLHSLVVGNL--TALTVNTKGGKRLATFGVVTKKMLKAFDVDNEVYYADLNWKELM.......................... 213
28 -24.0003g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  18  21..........................................................................AAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPFETRFVGPGHSQGINLYLMTSPEYHMKRLLAA---------PVFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDMYMNEVDDLLQQVLDCQPAESLSYQQAFQRHLEIDPLSADKTQLREAALFTMGVEPHIGKEKPTFIYHFPASQASLAQISTEDHRVAERFEVYYKGIEL.. 246
29 -23.7003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  18  34..........................................................................AAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGPGHSQGMNLWLMTSPEYHMKRLLVA---------PVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPLSADKTQLREVALFTFGVEPNIGKEKPTFVYHFPASQASLAQISTEDHRVAERFEVYYKGIEL.. 259
30 -23.7003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  15  15..........................................................PSGFPEFLPSEKR--ELYLLDTIRRVYESYGFTPIETPAVERLEVLQAKGNQGDNIIYKSGDTGSEARALKFDQTVPLAAYIARHLNDLTFPFARYQMDVVFRGERAKDGRFRQFRQCDIDVVGREKYDAQMPAIITEIFEAVNIGDFVIRINNR-FFQSLNISETQIKSCISIIDNLEKIGEAKVKLELEKEGINPEQTQKI........................ 239
31 -23.3003ica_A mol:protein length:213 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  17  8...........................................................................KWQTVVSEQLVGAGFNEILNNSLTAGSYYEGLKSHPREMAVELMNPLSQELCMRQTLLFGGLETLSHNLRRKHLSLYLFEWGKCYRFHAAKRTDYAEDDRLGIWICGQRVHNSELKAVVEQVLCRVGIETGAYTLKTA--SAMEVKTRSGKLLGTFGTVSTELIKRFEIEQPVYFAELLWDALM.......................... 213
32 -21.3003l4g_B mol:protein length:589 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  13  318VGIRETPENLAKLLTRMYLKSEVIGDGNQIEIEIPPTRADIIHACDI--VEDAAIAYGYNNIQMTLPKANQFPLNKLTELLRHDMAAAGFTEALTFALCSQEDIADVDISATKAVHISNPKTAEFQVARTTLLPGLLKTIAA-NRKMPLPLKLFEISDIVIKDSNTDVGAKNYRHLCAVYYNKNPGFEIIHGLLDRIMQLLDVPPGEDKGGYVI-GRCAEIFARGQSVGKLGVLHPDVITKFELTMPCSSLEINIGPFL.......................... 589
33 -20.7001usy_A mol:protein length:275 ATP PHOSPHORIBOSYLTRANSFERASE REGULATORY SUBU  ali model follow..  15  7...........................................................................EKVFSFYSKATKKGFSPFFVPALEKAEEPA---------GNFFLDRKGNLFSIREDFTKTVLNHRKRYSP--DSQIKVWYADFVYRYSG---SDLVAEYQLGLEKVPRNSLDDSLEEIIVESASEFFEGPVIVEGHTGVYEDLLKEIPKDLH-TKNLAEIEFLSHMKKIDLSRVEKIIEDSIYRRSPEHLKTMDLPLSVREDLLSASSFL 212
34 -20.7004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  15  6...............................................FELRRQFVLKTPKGTRDYSPRQMA--REKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYL---AMNKLTNIKRYHIAKVYRRDNPTRGRYREFYQCDFDIAGNFDPMAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICG-LDKVSWEEVKNEMVGEKGLAPEVAD----IGDYVQQHGGVSLVEQLLQDPKLSQN..... 250
35 -20.4004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  13  12MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMA--REKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYL---AMNKLTNIKRYHIAKVYRRDNPTRGRYREFYQCDFDIAGNFDPMAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICG-LDKVSWEEVKNEMVGEKGLAPEVAD----IGDYVQQHGGVSLVEQLLQDPKLSQN..... 303
36 -20.2003mey_A mol:protein length:346 Bll0957 protein  ali model follow..  14  1............................MGSSSSGLVPRGSHMNIAVLPNSPDTAPQIADPLDHLADKLRTALYESIVERLAALIREAGTEALRFPPVMSRAQLEKSGSRFDAGGDWTTSLSPADLVLSPAACYPVYPIAASRGPLPKGGLRFDVAADCFRRESKHLDRLQSFRMREYVCIGTPDDVERWMVRAQAIARDLGLTFRVDYASDPFFGRPLRSEEQPTACMSFNYHREHFGTTWGIQDA--CVAFGMDRLAVA........................ 304
37 -19.9004h2w_A mol:protein length:346 Amino acid--[acyl-carrier-protein] ligase 1  ali model follow..  14  1............................MGSSSSGLVPRGSHMNIAVLPNSPDTAPQIADPLDHLADKARTALYESIVERLAALITEAGTEALRFPPVMSRAQLEKSGSRFDAGGDWTTSLSPADLVLSPAACYPVYPIAASRGPLPKGGLRFDVAADCFRRESKHLDRLQSFRMREYVCIGTPDDVERWMVRAQAIARDLGLTFRVDYASDPFFGRPLRSEEQPTACMSFNYHREHFGTTWGIQDA--CVAFGMDRLAVA........................ 304
38 -16.7001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  16  76............KADKRAPRGIELHAEEITLLSKAKAPLPLDVSGKVKADIDTRLRERVLDLRRQEMQAVIKIQSLALKAFRETLYKEGFIEIFTPKIIASATEGGAQLFPVIYFGKEAFLAQSPQLYKELMAGVVE--------------RVFEVAPAWRAEESDTFHLAEFISMDVEMADYNDVMQLLEKILHNIVKTIKEEYTKSKSENPELSESFDLIYKFLEIVSGSTRNHKREKKKGLKPESFGFGMGLARLMVMLTGIQSVKEI.............. 417
39 -16.6001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  20  79............NFTPKAKLGFEILPEKIVVLNRAETPLPLDPTGKVKAELDTRLNNRFMDLRRPEVMAIFKIRSSVFKAVRDFFHENGFIEIHTPKIIA------TATEGGTELFPMKYFEEDAFLAE---SPQLYKEIMMASG------RVYEIAPIFRAEEHNTRHLNEAWSIDSE-MAFIEDEEEVMSFLERLVAHA---YIMKYDNKPEICRAFDLEYRGVEISSGGQREHRHDKEKGLNPESFGFGLGAERLIKQMLDLPNIREV.............. 426
40 -16.6003a74_A mol:protein length:493 Lysyl-tRNA synthetase  ali model follow..  16  112VGVRGTMFKTKVGELSIKVSSYEFLTKALRPL-----------PEKYHGLKDIEQRYRQRYLDLIMNPESKKTFSLIIQSMRRYLDSHGYLEVETPMMHAV-----AGGAAARPFITHHNALDMTLYMRIAIELHLKRLIVGGLE------KVYEIGRVFRNEGISTRHNPEFTMLELYEAYAD--FRDIMKLTENLIAHIATE................................................................................. 294
41 -16.6003bju_A mol:protein length:521 Lysyl-tRNA synthetase  ali model follow..  18  114IGVQGNPGKTKKGELSIIPYEITLLSPCLHML-----------PHLHFGLKDKETRYRQRYLDLILNDFVRQKFSKIITYIRSFLDELGFLEIETPMMNII-----PGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVG---------RVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYAD--YHDLMEITEKMVSGM.................................................................................... 293
42 -16.4004up7_A mol:protein length:777 LYSINE--TRNA LIGASE  ali model follow..  18  112CGFTGHPTRTKTGELSLIPISGMILSPCLHML-----------PSMHYGLGDQETRFRKRYLDLIVNPESVKNFTKVVKAVRKYLDDKGFLEVETPILNTI-----PGGATARPFITHHNQLDIQMYMRIAPELYLKELVVG---------RVYEIGRLFRNEGIDQTHNPEFTTCEFYMAYAD--YNDIMKMTEELLGNM.................................................................................... 291
43 -16.2001bbu_A mol:protein length:504 PROTEIN (LYSYL-TRNA SYNTHETASE)  ali model follow..  20  121LGAKGKLFKTKTGELSIHCTELRLLTKALRPL-----------PDKFHGLQDQEARYRQRYLDLISNDESRNTFSQILSGIRQFMVNRGFMEVETPMMQVIP-----GGAAARPFITHHNALDLDMYLRIAPELYLKRLVVG---------RVFEINRNFRNEGISVRHNPEFTMMELYM--AYADYKDLIELTESLFRTLAQD................................................................................. 303
44 -16.2001e1o_A mol:protein length:504 LYSYL-TRNA SYNTHETASE, HEAT INDUCIBLE  ali model follow..  19  121IGARGTLFKTQTGELSIHCTELRLLTKALRPL-----------PDKFHGLQDQEVRYRQRYLDLIANDKSRQTFSKILAAIRQFMVARGFMEVETPMMQVIP-----GGASARPFITHHNALDLDMYLRIAPELYLKRLVVG---------RVFEINRNFRNEGISVRHNPEFTMMELYM--AYADYHDLIELTESLFRTLAQE................................................................................. 303
45 -15.8004ex5_A mol:protein length:529 Lysine--tRNA ligase  ali model follow..  18  136VAARGVLFRTNKGELSVKCTQLRLLAKALRPL-----------PDKFHGLADQETRYRQRYVDLIVTPETRTTFTKAIASIRKFMGDADFMEVETPMLHPIP-----GGAAAKPFVTHHNALDMEMFLRIAPELYLKRLIVG---------RVFEINRNFRNEGVSPRHNPEFTMMEFYA--AYTDYRWLMDFTERLIRQAAVD................................................................................. 318
46 -15.7001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  22  19..........................................................................TKILEYMTDFFVKEGFKWLLPVIISPITDPLWPDPAGEGMEPAEVEIYGVKMRL------THSMILHKQLAIAMGLKKIFVLSPNIRLESRQKDHAYEFTQLDFEVERAKLIERLVYGLFRKAEEWTGREFPKTKREVFEYSEVLEEFGSDEEVASGGEREWEYEAKAGKLKPSAGAGIGVERLVRFIVGAKHIAEV.............. 281
47 -15.7003w3s_A mol:protein length:527 Type-2 serine--tRNA ligase  ali model follow..  16  148...RRHVIDRVIRLVAWAVEERSELVERVTKVEPGTVVDESGPRRIRFRGDVTEEARRRGWVKEFPGRGQTPPMAALFEVLRDFLLELGFEPALFPKLIPLETMFRMRPELFDDFKRELYVWGEGYVLAPAQCEPFYELLREVVDPERLPIKLYDCGWTYRWEGKGLERVNEFQRIEHVWIAEPEEARELLEATKRVAEELELEWKVVVSDYLPFKGERSSEEAWISVGSFNVHGEHFVDGFNVKEK--CAGLGVTRWVVG........................ 489
48 -15.4002cim_A mol:protein length:522 SERYL-TRNA SYNTHETASE  ali model follow..  12  149VGEAEMKNRVPDRILTLLEEKIEAAQYGAKAEHWNLLWQREPMEHPFKEDPTQAMMKEGWLKRGSSRG-HGPQSARIFRTFEKIVLELGYREMIFPKLVTWEVWMKSGTHEVPTKLIKEKIAEPIGGMCYAQCPPFWMYVAGETLPNEEPVKVFDRGTSHRYESHGIERVDEFHRIEIVWIGTKEEVLKLHDRYMHIFNDILDIEWRKARVTPWFMAQEGLLGEWLEFQNVSINGDKYPKGFNVKLQ---SGVGLERWAAVQKGLDPANWPEEFRNRVGEMPKGI 513
49 -15.4004ycv_A mol:protein length:516 Lysine--tRNA ligase  ali model follow..  20  115VGIVGFPGKSKKGELSIFPKETILLSACLHMLPMK-------------GLKDTEIRYRQRYLDLLINESSRHTFTKIINFLRNFLNERGFFEVETPMMNLI-----AGGANARPFITHHNDLDLDLYLRIATELPLKMLIVG---------KVYEIGKVFRNEGIDNTHNPEFTSCEFYWAYAD--YNDLIKWSEDFFSQL.................................................................................... 293
50 -15.3003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related  ali model follow..  25  19..........................................................................TKILDYMTKFFTDRGFKWLLPIMLSPITDPLWPDPAGEGIRPAEVDVYGVRMRL------THSMILHKQLAIAMGLEKIFVLSPNIRLESRRKDHSYEFTQLDFEI--EGAKMKDVMRLIEELIYGLGSDEKASMEMEEPFNYDLILPYGYGEVSSGGEREWEYEARAGKLKPSAGAGIGVERLVRFIVGAKHIAEV.............. 281
51 -15.3003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  17  189...............LKDNEGKDLTKRPLKDEYAKLLKEKASAQKYVKVSQDTRLDNRMLDLRTVTNIAIFRIQSACCGLFREFLTSQKFVEIHTPKLIG------CSSEGGSNIFEVKYFDRKAYLAQ---SPQLYKQMAIMGD------KVFEVGPVFRAENSNTRHLTEFEGLDIE-MEIVENYHECIDVMEKLFTFI---YTMPDIDDPNYSNSYDVFVRGQEITSGAQRIHDPEIEKGVDPATLGCGIGLERITMLYLGIPNIRKV.............. 536
52 -15.2001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  19  66............VENAKAPGGLEVQAKEVEVLSPALEPTPVEIPKEEWRANPDLLEYRYVTLRGEKARAPLKVQAALVRGFRRYLDRQDFTEIFTPKVVR------AGAEGGSGLFGVDYFEKRAYLAQ---SPQLYKQIMVGVFE-----RVYEVAPVWRMEEHHTSHLNEYLSLDVEMVGQDLSEEAERLLGEYAKERWGSDWLFVYPEEDGTTRSFDLLFRGLEITSGGQRIHRYEKAKGMDPEAFGFAIGAERLTQKLLGLPNVRYA.............. 410
53 -15.2004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  18  132.GVVRKVNQKIGSCTQQDVELHVQKIYVISLAEPRLPLQLDDAVRPEAEGEEERLDNRVIDLRTSTSQAVFRLQSGICHLFRETLINKGFVEIQTPKIIS------AASEGGANVFTVSYFKNNAYLAQ---SPQLYKQMCICAD------KVFSIGPVFRAEDSNTRHLTEFVGLDIE-MAFNYHYHEVMEEIADTMVQI---YTMPDPRNPKQSNSYDMFMRGEEILSGAQRIHDPQLHHGIDLEKIGGGIGLERVTMLFLGLHNVRQT.............. 503
54 -14.3001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  15  103.GIVKKVDEPIKSATVQNLEIHITKIYTISETPEALPILLEDASRSEAEAEAARLDYRVIDLRTVTNQAIFRIQAGVCELFREYLATKKFTEVHTPKLLG------APSEGGSSVFEVTYFKGKAYLAQ---SPQFNKQQLIVAD------RVYEIGPVFRAENSNTRHMTEFTGLDME-MAFEEHYHEVLDTLSELFVFI---YTMPDPANPKYSNSYDFFMRGEEILSGAQRIHDHAKAHGLSPE--GGGIGLERVVMFYLDLKNIRRA.............. 478
55 -14.0004rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  17  75..EVRPEGNENPEIPTGQIEVNATELTVLGESAPLPFQLDEQAGEEAR------LKYRYLDLRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTL-----------------TRSTPEGARDFLVPARLQPGSFYALPQSPQLFKQLLRYYQIARCYRDEDFRADRQPEFTQLDMEMVEADDVIAISEQVLKAVWATIGYD---------------------LPLPLPRISYEEAMRRFGSDKPDLRFGIELVECTEYFKDTT................... 302
56 -13.9002i4l_A mol:protein length:458 Proline-tRNA ligase  ali model follow..  18  1MGSSSSGLVPRGSHMRLSRFFLPILKENPKEAEIVSHRLMLRAG---------MLRQEAAGIYAWLPLGHR-VLKKIEQIVREEQNRAGAIELLMPTLQLADLWRESGDAYGPEMLRIADRHKRELLYGPTNEEMITEIFRAYIKSYKSPLNLYHIQWKFRDERFGVMRGREFLMKDAYSFDVDEAGARMFVAYLRTFARMGLKAIPMRAETGPIGGDLS................................................................. 221
57 -13.9001efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model follow..  17  73.GLVRLRPEPNPRLATGRVEVELSALEVLAEAKTPPFPVDAGWRGEEEKEASEELRLKYRYLDLRRRRMQENLRHRVIKAIWDFLDREGFVQVETPFL-----------------TKSTPEGARDFLVPYRHEPGLFYALPQSPQLFKQMLRYFQIARCFRDEDLRADRQPDFTQLDLEM--SFVEVEDVLELNERLMAHV-----------------REALGVELPLPFPRLSYEEAMERYGSDKPDLRFGLELKEVGPLFRQSG................... 310
58 -13.9004o2d_A mol:protein length:620 Aspartate--tRNA ligase  ali model follow..  17  91..EVRPEGNENPEIPTGQIEVNATELTVLGESAPLPFQLDEQAGEEAR------LKYRYLDLRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTL-----------------TRSTPEGARDFLVPARLQPGSFYALPQSPQLFKQLLRYYQIARCYRDEDFRADRQPEFTQLDMEMVEADDVIAISEQVLKAVWATIGYD---------------------LPLPLPRISYEEAMRRFGSDKPDLRFGIELVECTEYFKDTT................... 318
59 -12.6001eqr_A mol:protein length:590 ASPARTYL-TRNA SYNTHETASE  ali model follow..  14  76..RARDEKNINRDMATGEIEVLASSLTIINRADVLPLDSNHVNTEEAR------LKYRYLDLRRPEMAQRLKTRAKITSLVRRFMDDHGFLDIETPML-----------------TKATPEGARDYLVPSRVHKGKFYALPQSPQLFKQLLRYYQIVKCFRDEDLRADRQPEFTQIDVETMTAPQVREVMEALVRHLWLEVDVADLLKSVEFAVFAGPANDPKGRVAAGGASLTRKQIDEYGNFVKIYGAKGLAYIKVNERAKGLEGINS............... 366
60 -12.1004wj3_M mol:protein length:599 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  13  75.....TGKVRLRPEGARNPNMASGSIEVLGEVLNQAETPPFPLDEYSDVGEETRLRYRFIDLRRPEMAAKLKLRARITSSIRRYLDDNGFLDVETPIL-----------------GRPTPEGARDYLVPSRTYPGHFFALPQSPQLFKQLLRYYQIAKCFRDEDLRADRQPEFTQIDIETLDESDIIGITEKMVRQLFKEVDVADQLKEVEFKVFSGPANDPKGRVAAGAASMPRSQIDDYTKFVGIYGAKGLAYIKVNERAKGVEGLQS............... 371
61 -12.0003a31_A mol:protein length:471 Probable threonyl-tRNA synthetase 1  ali model follow..  14  7.............................KTHIDYAYELDITVKPDSRVPNREFATFTGAGVPLFSLGGGP--RYALAEVLAKFHARRGYYVVETPIIASTELFKVSGHEFYRNNMYLFDIEGHEFAVKPMNCPYHILLFLNEVAKHRSPFKVFEFGRVHRYEPSGSIYVRGFTQDDAHIIDVVYDVFEEMKLVLERLFKLGVSSETFKVRLSMSDKSLIG-----------------KEFMGSKEEWEGAEEALREAASEKYGIDIVELEGEAAFYGPKLDFIM 265
62 -11.9001wle_A mol:protein length:501 Seryl-tRNA synthetase  ali model follow..  16  157VGDESQARVLHVVGDKPAFSFQPRG-----EIAEKLDIIRQKRLSHVSGHRSYYLRGAGALLQ-----------HGLVNFTLNKLIHRGFTPMTVPDLLRGVVFEGCGM-KPSQIYNIDPSRFEDLNLAGTAEVGLAGYFMHSVAFRDLPIRMVCSSTCYRAETDTGKRVHHFTKVEMFGVQSSELLEEFLSLQMEILTELGLHFRVLDPGRGRFGEVTSASNTDFQSRRLHIMFQTEAGELQFAHTVNATGCAVPRLLIA---LESYQQKDGSVLVPPALQ... 459
63 -11.8001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  16  75.....EGIVKADERAPGGAEVHVEKLEVIQAVSEFPIPENPEQASPELLLDYRHLHIRTPKASAIM-----KVKETLIMAAREWLLKDGWHEVFPPILVTGA------VEGGATLFKLKYFDKY-----AYLSQSAQLYLEAAIFGLE---KVWSLTPSFRAEKSRRRHLTEFWHLELEAMDLWDIMKVEEELVSYMVQRT-LKNTEPPFPRISYDEAIDILQS--EIIGGSQREDDYDLEEGMDPKDYGFGLGVERLVAWVLKLDHIRWA.............. 422
64 -11.8004hwo_A mol:protein length:411 Threonine--tRNA ligase  ali model follow..  20  36..........................................................................RELEVFVRSKLKEYQYQEVKGPFMMDRVLWEKTGHDNYKDAMFTTSSENREYCIKPMNCPGHVQIFNQGLKSYRDPLRMAEFGSCHRNEPSGSLHVRGFTQDDAHIFCTEEQIRDCIRLVYDMYSTFGFEKIVVKLSTRP....................................................................... 185
65 -11.6003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  14  91LNAYAGKNHPPEIADILNLEMQVTEWKVIGESPIDLENIINKDSSIPQKMQNRHIVIRSEHTQQVL-----QLRSEIQWYFRKYYHDNHFTEIQPPTIVKTQ------CEGGSTLFKLQYFNEP-----AYLTQSSQLYLESVIASLG---KSFCMLSSYRAEQSRVRHLAEYLHLEAELISFEDLLNHLEDLVCTVIDNVHLKLPTRPFKRMTYADAIKYCND--EIVGGSMRIWNYDKANGLNPDPYGYGLGVERLVMWLLGEDHIRKV.............. 444
66 -11.6004ah6_A mol:protein length:617 ASPARTATE--TRNA LIGASE, MITOCHONDRIAL  ali model follow..  17  80.....SGTVISRPAGQENPKMPTGEIEIKVELLNACKKLPFEIKNFVKKTEALRLQYRYLDLRSFQMQYNLRLRSQMVMKMREYLCNHGFVDIETPTL------FKRTPGGAKEFLVPSREPGKFYSL-----PQSPQQFKQLLMVGG---RYFQVARCYRDEGSRPDRQPEFTQIDIEM--SFVDQTGIQSLIEGLLQYS-----------------WPNDKDPVVVPFPTMTFAEVLATYGTDKPDTRFGMKIIDISDVFRNTE................... 313
67 -11.6001nyq_A mol:protein length:645 threonyl-tRNA synthetase 1  ali model follow..  16  226.............................KELKAHLQMLEERKERDHRKIGKELSQLVGAGLPLWLPNGAT--RREIERYIVDKEVSMGYDHVYTPVLANVDLYKTSGH-QEDMFPPMQLDETESMVLRPMNCPHHMMIYANKPHSYREPIRIAELGTMHRYEASGAQRVRGMTLNDSHIFVRPDQIKEVVNMIIDVYKDFGFEDYSFRLSYRDPEDKEKYFDDDDMWNKAENMLKEAADELGLS-EAAFYGPKLD----------QVKTAMGKEETLSTAQLDF 493
68 -11.5004p3n_A mol:protein length:415 Threonine--tRNA ligase, cytoplasmic  ali model follow..  17  2...................................GSSSSGDHRKIGRDQELYFFHELSPGSCFFLPKGAY--YNALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFSFEVEKEFALKPMNCPGHCLMFDHRPRSWREPLRLADFGVLHRNELSGATRVRRFQQDDAHIFCAMEQIEDCLDFLRTVYSVFGFSFKLNLSTR......................................................................... 187
69 -11.5003lsq_A mol:protein length:484 Seryl-tRNA synthetase  ali model follow..  19  214............................................................................LVSYSLDFLVKRGYTPFYPPFFLNRDVMGEVAQQFDEELYQVSGDGDKKYLIATSEMPIAAYHRGRWFTELKEPLKYAGMSTCFRKEAGAHGRVHQFDKIEQFVVESWRHLEDMITTSEEFNKSLGLPYRVVN............................................................................ 361
70 -11.2004hwt_A mol:protein length:413 Threonine--tRNA ligase, cytoplasmic  ali model follow..  17  1......................................MARDHRKIGRDQELYFFHELSPGSCFFLPKGAY--YNALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFSFEVEKEFALKPMNCPGHCLMFDHRPRSWREPLRLADFGVLHRNELSGATRVRRFQQDDAHIFCAMEQIEDCLDFLRTVYSVFGFSFKLNLSTR......................................................................... 183
71 -11.2001qf6_A mol:protein length:642 THREONYL-TRNA SYNTHETASE  ali model follow..  15  203.GAYWRGDSNNKMLQRIYGTAWADKKALNAYLQRLEEAAKRDHRKIGKQLDLYHMQEEAPGMVFWHNDGWT--FRELEVFVRSKLKEYQYQEVKGPFMMDRVLWEKTGHDNYKDAMFTTSSENREYCIKPMNCPGHVQIFNQGLKSYRDPLRMAEFGSCHRNEPSGSLHVRGFTQDDAHIFCTEEQIRDCIRLVYDMYSTFGFEKIVVKLSTRP....................................................................... 424
72 -11.0001ser_A mol:protein length:421 PROTEIN (SERYL-TRNA SYNTHETASE (E.C.6.1.1.11)  ali model follow..  13  172............................................................................LLRFAMDFMARRGFLPMTLPSYAREKAFLGTGHFPAYRDQVWAIAETDLYLTGTAEVVLNALHSGEILPYEALPLRYAGYAPAFRSEAGSFGRVHQFHKVEQYVLASDRAFQELLENAEEILRLLELPYRLVEPSEGRYRETHSCSALDWQARRANLRYRDPEGRVRYAYTLNNTALATPRILAM---LENHQLQDGRVRVPQALI... 409
73 -10.9002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUT  ali model follow..  17  117.....................................................MLDNRHLVIRGENAAALLRLRAAATRAMREHFYNAGYVEVAPPTLVQTQ------VEGGSTLFNLDYFGEQ-----SFLTQSSQLYLETCIPTLG---DVFCIAQSYRAEKSRRRHLAEYAHVEAECITLDDLMEKIEELVCDTVDRLKFQPPERPFLRMEYKDAIKWLQE--EIVGGSMRIWKFDKNVEIDPKPYGYGLGLERFICWLTNTNHIRDV.............. 425
74 -10.6003err_A mol:protein length:536 fusion protein of microtubule binding domain  ali model follow..  12  269................................................................ALKGDLALYELALLRFAMDFMARRGFLPMTLPSYAREKAFLGTGHFPAYRDQVWAIAETDLYLTGTAEVVLNALHSGEILPYEALPLRYAGYAPAFRSEAGSFGRVHQFHKVEQYVLASDRAFQELLENAEEILRLLELPYRLVEPSEGRYRETHSCSALDWQARRANLRYRDPEGRVRYAYTLNNTALATPRILAM---LENHQLQDGRVRVPQALI... 518
75 -10.5002rhs_B mol:protein length:800 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  10  424IGFNLSNDEIQSIFRQLGFETTLKGETLTVNVPSRRKDITIKED-----IEEVARIYGYDEIPSSLPSGELTDRQHKTRTLKETLEGAGLNQAITYSLVSKDHAKDFALQERPTISLLMPMSEAHATLRQSLLPHLIEATAYNVARKNKDVRLYEIGRVFFGNGEGE---DEVEYLSGILTGEEIDFFIAKGVVDRVAEKLNLEFSYKAGKIEGLGRTAIVSLGGAGIGFIGELHPQVAADNDLKRTYV-FELNYDAMMQVAVGYINYEQIPKFPGVTRDIALEV 721

FFAS is supported by the NIH grant R01-GM087218-01
1 2 4 5 2 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Grynberg M, Godzik A. NERD: a DNA processing-related domain present in the anthrax virulence plasmid, pXO1. Trends Biochem Sci. 2004 Mar;29(3):106-10.