current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 4bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .
# Score Template Links and tools%idFirst MGSSSSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLGNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPRPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNLLast
1 -108.0004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model  100  1MGSSSSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLGNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPRPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 285
2 -97.5003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  97  3.....GGLVPRGSHGASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLTPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLVFWQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSALVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 282
3 -94.7002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  98  1MGSSSSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSGSYYNGISTNL 285
4 -93.4005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  98  3...................ALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLAFAQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 268
5 -93.2004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  99  3...................ALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLANYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 268
6 -92.1004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  98  1MGSSSSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLSFIQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 285
7 -90.8004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  97  1..................PALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMVAPNIFNYARKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFFQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCSVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 267
8 -76.4002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  41  1MGSSSSGLVPRGSHMFLTRRVQYQRLKELNASGEQLEMGFSDRDRAFQGIEHQLMSQGKRHLEQLRTVKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEDHPLFSQVFWLDGKKCLRPMLAPNLYTLWRELERLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPERHQRLEDMARWVLEAAGIEFELVTESSVVYGDTVDVMKGDLELASGAMGPHFLDEKWEIFDPWVGLGFGLERLLMIREGTQHVQSMARSLSYLDGVRLNI 301
9 -45.8003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  16  2..................................AMGTLEAQTQGPGSMQKNMVETEPVQGCRDFPPEAMR-CRRHLFDVFHATAKTFGFEEYDAPVLESEELYIRKAGEETEQMFNFITKGGHRVALRPEMTPSLARLLLGKGRSLLLPAKWYSIPQCWRYEAITRGRRREHYQWNMDIVGVKSVSAEVELVACWAMRSLGLDVGIKVNSRKVLQTVVEQAGVTSDKFAPVC--VIVDKMEKIPREEVEAQLAVEIAQRVGEEHEAVKELRQFFEQVEAYGYG. 275
10 -44.5003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  14  2..................................AMGTLEAQTQGPGSMQMNMVETEPVQGCRDFPPETMR-LRKYLFDVFHSTARKFGFEEYDSPVLESEELYRKAGEEITEQMFNFITKGGHRVALRPEMTPSLARQLLAKGRSLLLPAKWYSIPQCWRYEAITRGRRREHYQWNMDIIGVKSVSSEVELVACTAMQSLGLDVGVKINSRKILQTVVEQAGVSAD--KFAPVCVIVDKMEKLPREEV-----VAQLAAIGLESNVVDAITSTLSLKTIDEI.. 248
11 -43.7004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  14  17...ALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGP--DESKQKFVLKTPKGTRDYSPRQMA-VREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLT---NIKRYHIAKVYRRDNPARGRYREFYQCDFDIAGNFDPMAECLKIMCEILSSLQIDFLVKVNDRRILDGMFAICGVSDSKFRT--ICSSVDKLDKVSWEEVKNEM................................ 264
12 -43.2004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  11  1..............................MAMGTLEAQTQGPGSMTEQKRKLEKLTGVKGMNDILPQDA-GLWEFFEATVKSLLRAYGYQNIRTPIVEHTPLFTRGIGEVTDIVEKEMYSNGENLTLRPENTAAVVRAAIEHNMLYDGPKRLWYIGPMFRHERPQRGRYRQFHQVGVEALGFAGPDADAEIVCQRLWEDLGLGIKLEINSLGLAEERAAHRVELIKYLEQHADKLDDDAQRRLYTNPLRV-VRNAPKLIDFLGDVSRAHFEGLQRLLKANNVPF 272
13 -42.7003od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  15  2...............................................NAMSKPFMFEKPFGMRDTLPEWYKT-KKNICDQMTEEINLWGYDMIETPTLEYYETVGVVSAILDQQLFKLLDQQGNTLVLRPDMTAPIARLVASSLKDRAYPLRLAYQSNVYRAQQNEGGKPAEFEQLGVELIGDGTASADGEVIMIAALKRAGLEFKVAIGHVGYVNALLMDVVGNEQRADR--LRRFLYEKNYVGYREHVKSLNLSTI........................... 212
14 -42.3004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  15  6...............................................FELRRQFVLKTPKGTRDYSPRQMA-VREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLT---NIKRYHIAKVYRRDNPTRGRYREFYQCDFDIAGNFDPMAECLKIMCEILSSLQIDFLVKVNDRRILDGMFAICGVSDSKFRT--ICSSVDKLDKVSWEEVKNEM................................ 211
15 -42.3001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  15  1..................................................MYRLQIEKIRGFRDFYPEDMD-VEKFIFKTAEEAAEAFGFRRIDFPSLEYLDLYRKSGEELLQQTYSFVDKGGREVTLIPEATPSTVRMVTSR-KDLQRPLRWYSFPKVWRYEEPQAGRYREHYQFNADIFGSDSPEADAEVIASSILDRLGLIYEIRINSRKIMEEIIG----GMTSSDPFSVFSIIDRYHKISREEFVDQLRDEMARITGKSSEEIARMAAVEDLLASYGVK. 255
16 -41.9002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  13  4...............................................YQDPMAKNIQAIRGMNDYLPGET-AIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTKEMYTFEDRNGDSLTLRPEGTAGCVRAGIEHGLLYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDIDAELITARWWRALGIHVTLELNSIGSLEARANYRDALVAFLEQHKEKLDEDCKRRMYTNPLRV-LNDAPALGDYLDEESREHFAGLCKLLESAGIAY 258
17 -41.7003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  15  1............................................SNAMAKNDKINFSTPSGFPEFLPSEKR-LELYLLDTIRRVYESYGFTPIETPAVERLEVLQAKGNQGDNIIDKSGDTGSEARALKFDQTVPLAAYIARHLNDLTFPFARYQMDVVFRGERAKDGRFRQFRQCDIDVVGREKLSAQMPAIITEIFEAVNIDFVIRINNRKVLTGFFQSLNISET--QIKSCISIIDNLEKIGEAKVKLEL................................ 226
18 -41.1003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  13  1.................................SNAMNGTRSAWGARAWEAVRGFADRPPGMQDGYPDFAKR-RRAVETRLLSFVEDAGYEPVTSGLFEYVDTLRARSPESSRDWIRLFDGGGDAVALRPEMTPSIARMAAPRVAAGRTPIRWCYCERVYRRTSWASGKAAESTQVGIERIGEEASVMDVLRLLHEASAAAGVHHRIVVSHARLVPRLLDALGISASLSRA--FLACLTSGNYVQFRELWQLHAAKDVDLLA....................... 237
19 -40.9005eln_A mol:protein length:535 Lysine--tRNA ligase  ali model follow..  17  111.FSVSHSEIRRGDVVGFTGFPGKSKRGELSLFSKSVVLLSPCYPTAISGLKDQEVRYRQRYLDLMLNEESRKVRSRAIKYIRNYFDRLGFLEVETPMLNMI-----YGGAAARPFITYHNELETQLYMRIAPELYLKQLI------VGGLDKVYEIGKNFRNEGIDLTHNPEFTAMEFYMAYAD--YYDLMDLTEELISGL-IDFTTPWKRFSFVEEIESGLGEKIELPHPRTAAKLLDKLAGCTNPSFIIDHPQTMSPLAKWHREKPEMTERFELFVLGKEL.. 435
20 -40.7003a74_A mol:protein length:493 Lysyl-tRNA synthetase  ali model follow..  15  99.QYELFKISDLGDIVGVRGTMFKTKVGELSIKVSSYEFLTKALPEKYHGLKDIEQRYRQRYLDLIMNPESKKTRSLIIQSMRRYLDSHGYLEVETPMMHAV-----AGGAAARPFITHHNALDMTLYMRIAIELHLKRLI------VGGLEKVYEIGRVFRNEGISTRHNPEFTMLELYEAYAD--FRDIMKLTENLIAHI-VDLTPEWRRLHMVDAIKEYVGVDFWRQMSDEEARELAKEHGVEQPTFIYGHPVEISPLAKKNPDDPRFTDRFELFIVGREH.. 412
21 -40.7005e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  11  1..................................................MAMSSIVAIKGFNDVLPTQTAA-WRRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRAIGDATDIVEKEMYTFPESLTLRPEGTAGCVRALVEHNLLRGATPRVWYMGPMFRYEKPQKGRYRQFHQFGVETFGVATPDIDAELITARLWKRMGVDVQLELNTLGETDERTEYRNALVAFLNEHKDALDEDSQRRLTTNPLRI-LENAPKLHDFLKEDSLSHFQQLQDYLTAAGIKF 254
22 -40.6001e1o_A mol:protein length:504 LYSYL-TRNA SYNTHETASE, HEAT INDUCIBLE  ali model follow..  16  108.YNDQFKKWDLGDIIGARGTLFKTQTGELSIHCTELRLLTKALPDKFHGLQDQEVRYRQRYLDLIANDKSRQTRSKILAAIRQFMVARGFMEVETPMMQVI-----PGGASARPFITHHNALDLDMYLRIAPELYLKRLV------VGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYAD--YHDLIELTESLFRTLAFDFGKPFEKLTMREAIKKYRPETITVEKSWGLGRIVTEIFDLIQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREI.. 422
23 -40.6001bbu_A mol:protein length:504 PROTEIN (LYSYL-TRNA SYNTHETASE)  ali model follow..  16  108.YNEQFKKWDLGDILGAKGKLFKTKTGELSIHCTELRLLTKALPDKFHGLQDQEARYRQRYLDLISNDESRNTRSQILSGIRQFMVNRGFMEVETPMMQVI-----PGGAAARPFITHHNALDLDMYLRIAPELYLKRLV------VGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYAD--YKDLIELTESLFRTLALDFGKPFEKLTMREAIKKYRPETIHVEKSWGLGRIVTEIFELIQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREI.. 422
24 -40.4001z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  12  2.........................................RGSGSIEGRMEKINYLLPEESAEMTLNQVKS-LRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGKEKMFQFIKHEGQSITLRYDFTLPLVRLYSQIKD--STSARYSYFGKIFRKEKRHKGRSTENYQIGIELFGESADKSELEILALQVIEQLGLKTVFEIGSAKFFQRLCQLADGSTELLTELLLKKDLSGLNAFIEK...................................... 211
25 -40.3004rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  17  1...................................................GPMTARAVRGTKDLFGKEL-RMHQRIVATARKVLEAAGALELVTPIFEETQVFEKGVGAATDEMFTFQDRGGRSLTLRPEGTAAMVRAYLEHMKVWPQPVRLWMAGPMFRAERPQKGRYRQFHQVNYEALGSENPILDAEAVLYECLKELGLRLKVKLSSVGDPEDRARYNAYLREVLSPHREALSEDSKERLELNPM.................................... 205
26 -40.3005hgq_A mol:protein length:524 Lysine--tRNA ligase  ali model follow..  14  103.FDNLHDRIKRGDIIGVNGYPARSKSGELSIIPYEIIQLTPCLPHTHFGLKNQETRYRMRYLDLIMNPDVKNRRSRMISFLRRYLDNLGFLEVETPMMNLI-----AGGATAKPFITHHNDLDMDLYLRVAPELYLKMLV------VGGIDRVYEIGRVFRNEGIDQTHNPEFTSCEFYMAYAD--YEDLMKITEDMLARM-VDFTPPFRKVNIYDGLQEKLGIQFPPADTLDTDEANKFFDKL-SPTFLTGHPQIMSPLAKWHRSIPGLTERFELFVVTKEI.. 430
27 -40.0003bju_A mol:protein length:521 Lysyl-tRNA synthetase  ali model follow..  15  101.FIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLPHLHFGLKDKETRYRQRYLDLILNDFVRQKRSKIITYIRSFLDELGFLEIETPMMNII-----PGGAVAKPFITYHNELDMNLYMRIAPELYHKMLV------VGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYAD--YHDLMEITEKMVSGM-VDFTPPFRRINMVEELEKALGMAVECPPPRTTARLLDKLVGCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEI.. 427
28 -40.0001qe0_A mol:protein length:420 Histidine--tRNA ligase  ali model follow..  14  3........................................................KIPRGTQDILPEDS-KKWRYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSTDEMYTFKDKGDRSITLRPEGTAAVVRSYIEHQGNPNQPIKLYYNGPMFRYERKQKGRYRQFNQFGVEAIGAENPSVDAEVLVMHIYQSFGLHLKLVINSVGDMASRKEYNEALVKHFEPVIHEFCSDCQSRLHTDPMRI-IKTAPRITDFLNEESKAYYEQVKAYLDDLGIPY 249
29 -39.8004ex5_A mol:protein length:529 Lysine--tRNA ligase  ali model follow..  14  123.TYDAFKKWDLGDIVAARGVLFRTNKGELSVKCTQLRLLAKALPDKFHGLADQETRYRQRYVDLIVTPETRTTRTKAIASIRKFMGDADFMEVETPMLHPI-----PGGAAAKPFVTHHNALDMEMFLRIAPELYLKRLI------VGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTD--YRWLMDFTERLIRQAELDLAQPFHRLTITQAIQKYAPSYTPAFLNAGIGALQLALFELWEPTFIIDYPIEVSPLARESDTVAGITERFELFITGREI.. 441
30 -39.6006aqh_A mol:protein length:508 Lysine--tRNA ligase  ali model follow..  15  107.LDNWKTYVDIGDIVFVHGEVITSKRGELSVLADSWQMAAKALPVAHKEMSEESR-VRQRYVDLIVRDQARKVRIAVMRAIRSALERRGFLEVETPMLQTL-----AGGAAARPFVTHSNALDTELYLRIAPELFLKRCL------VGGFERVFELNRVFRNEGADSTHSPEFVMLETYQAYGT--YDDSAVVTRELIQEVAYDLDGEWESIQMYPSLSEALGEEITPDTPAETLWAIADRLGLDAPTFVKDFPVETTPLTRSHRSIPGVTEKWDLYVRRIEL.. 422
31 -39.5005vl1_A mol:protein length:506 Lysine--tRNA ligase  ali model follow..  15  104.LDRWKADVDIGDVVYVHGTVISSRRGELSVLADSWRMAAKALPVAHKEMSEESR-VRQRYVDLIVRPQAREVRIAVIRAVRNALERRGFLEVETPMLQTL-----AGGAAARPFVTHSNALDIDLYLRIAPELFLKRCI------VGGFDRVFELNRVFRNEGSDSTHSPEFSMLETYQTYGT--YDDSALITRELIQEVAYDIDGEWATMEMYSSLSEALGEQITPETTVARLRDIASGLDVEAPTFVKDFPVETTPLTRQHRSIPGVTEKWDLYVRGVEL.. 418
32 -38.9004ycv_A mol:protein length:516 Lysine--tRNA ligase  ali model follow..  18  102.FAECYDKIRRGDIVGIVGFPGKSKKGELSIFPKETILLSACLHMMKYGLKDTEIRYRQRYLDLLINESSRHTRTKIINFLRNFLNERGFFEVETPMMNLI-----AGGANARPFITHHNDLDLDLYLRIATELPLKMLI------VGGIDKVYEIGKVFRNEGIDNTHNPEFTSCEFYWAYAD--YNDLIKWSEDFFSQLNTILEQPFDSNETIEKMINIIKEKIELPNPPTAAKLLDQLASNDKPFFIVEHPQIMSPLAKYHRTKPGLTERLEMFICGKEV.. 426
33 -38.8006chd_A mol:protein length:597 Lysine--tRNA ligase  ali model follow..  14  169.FIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLPHLHFGLKDKETRYRQRYLDLILNDFVRQKRSKIITYIRSFLDELGFLEIETPMMNII-----PGGAVAKPFITYHNELDMNLYMRIAPELYHKMLV------VGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYAD--YHDLMEITEKMVSGM-VDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDI-NPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEI.. 495
34 -36.0006FTT Entity 1(prereleased)  ali follow..  4..........................................................PDGVADVLFEDAHK-QEVLRHQLTQQLITHGYQLVSPPMIEFTESLLSGASEDKRQTFKIIDQLTRLMGIRADITPQILRIDAHHGG--DGIARYCYAGDVIHTLPSGLFGSRTPLQLGAEIFGCESIAADIELILFSMINSLDMSLHVDLGHVTIFKRLAELAALSASDTEQ--LMQLYANKNLPELKQVCQVLPMG............................. 202
35 -36.0005m8h_A mol:protein length:388 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  4..........................................................PDGVADVLFEDAHK-QEVLRHQLTQQLITHGYQLVSPPMIEFTESLLSGASEDKRQTFKIIDQLTRLMGIRADITPQILRIDAHHGG--DGIARYCYAGDVIHTLPSGLFGSRTPLQLGAEIFGCESIAADIELILFSMINSLDMSLHVDLGHVTIFKRLAELAALSASDTEQ--LMQLYANKNLPELKQVCQVLPMG............................. 202
36 -34.7003g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  18  15....................................................................PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPFETRFVGPGHSQGINLYLMTSPEYHMKRLLAAGCG------PVFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDRLMNEVDDLLQQVLDCQPAESLSYQQAFQRHLEIDPLSADKTQLREAALFTMGVEPHIGKEKPTFIYHFPASQASLAQISTEDHRVAERFEVYYKGIEL.. 246
37 -34.4003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  17  2................................................GSSSSGLVPRGSHMSETAS-PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGPGHSQGMNLWLMTSPEYHMKRLLVAGCG------PVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPLSADKTQLREVALFTFGVEPNIGKEKPTFVYHFPASQASLAQISTEDHRVAERFEVYYKGIEL.. 259
38 -34.2002rhq_A mol:protein length:294 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  16  3.................................SSSSGLVPRGSHMGTELMEKLNQQLAEETIDVISIGSKHPLTRTVEEIEDLFLGLGYEIVDGYEVEPKSHPARDMQDS--------FYITDEILMRTHTSPVQARTMEKRNG--QGPVKIICPGKVYRRDSDDATHSHQFTQIEGLVVDKNIKMSDLKGTLELVAKKLSVEVDVSCFKCKGKGCNVCKHTGWIEILGAGMVHPNVLEMAGFDSNGFAFGMGPDRIAMLKYGIEDIRYFYTNDV......... 274
39 -34.1001b70_A mol:protein length:350 PHENYLALANYL-TRNA SYNTHETASE  ali model follow..  16  26.......LGKKGLLTQEMKGLSALPLEERRKRGQELNAIKAALEAALEAREKALEEAALKEALERLFSGGLHPITLMERELVEIFRALGYQAVEGPEVEPEHHPARDMWDTFRLEGPLGEEVEGRLLLRTHTSPMQVRYMVAH----TPPFRIVVPGRVFRFEQTDATHEAVFHQLEGLVVGEGIAMAHLKGAIYELAQALDSKVRFQPVYFPFVEPGAQFGGKWLELGGAGMVHPKVFQAVDAYRERFAFGLGVERLAMLRYGIPDIRYFFGGRLFLEQFKGVL 350
40 -33.1001usy_A mol:protein length:275 ATP PHOSPHORIBOSYLTRANSFERASE REGULATORY SUBUNIT  ali model follow..  13  6..........................................................................FEKVFSFYSKATKKGFSPFFVPALEKAEEPA---------GNFFLDRKGNLFSIREDFTKTVLNHRKRYSP--DSQIKVWYADFVYRYSG---SDLVAEYQLGLEKVPRNSLDDSLEVLIVESASEFFEPVIVEIGHTGVYEDLLKE----IPKDLHEKVLNLIDTKNLAEIEFLSHMKKID............................. 172
41 -32.1003l4g_A mol:protein length:508 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  17  183.............................TSISKQETELSPEMISSGSWRDRPFKPYNFLAHGVLPDSGHLHPLLKVRSQFRQIFLEMGFTEMPTPARDQHDTFSQGGYGSQGYKYNWKLDEARKNLLRTHTTSASARALYRLAQKKPFPVKYFSIDRVFRNETLDATHLAEFHQIEGVVADHGLTLGHLMGVLREFFTKLGITQLRFKPAYNPYTEPSMEVKKWVEVGNSGVFRPEMLLPMGLPENVIAWGLSLERPTMIKYGINNIRELVGHKVLQMVYDSPL 492
42 -32.0004up7_A mol:protein length:777 LYSINE--TRNA LIGASE  ali model follow..  19  99.FVSLTKMIYRGDICGFTGHPTRTKTGELSLIPISGMILSPCLPSMHYGLGDQETRFRKRYLDLIVNPESVKLRTKVVKAVRKYLDDKGFLEVETPILNT-----IPGGATARPFITHHNQLDIQMYMRIAPELYLKELV------VGGINRVYEIGRLFRNEGIDQTHNPEFTTCEFYMAYAD--YNDIMKMTEELLGNM.................................................................................... 291
43 -31.6005x6c_A mol:protein length:553 O-phosphoserine--tRNA(Cys) ligase  ali model follow..  13  64.....METIERLRQAYLRMGFEEMINPVIVDEMEIYKQFGPEAMAVLDRCFYLAGLPRPDVGLGNEKVEIIKNLGIDIDEEKKERLREVLHLYKKGAIDGDDLVFEIAKALNVSEFKDLKPESTTLTLRSHMTSGWFITLSSLIKKRKLPLKLFSIDRCFRREQEDRSHLMSYHSASCVVVGEDVSVDDGKVVAEGLLAQFGFKFKPDEKKSKYYTPETQTLGEWIEVATFGVYSPIALAKYNIDVPVMNLGLGVERLAMIIYGYEDVRAMVYPQF......... 359
44 -29.1003pco_A mol:protein length:327 Phenylalanyl-tRNA synthetase, alpha subunit  ali model follow..  14  32.......LGKKGHLTLQMTTLRELPPEERPAAGAVINEAKEQVQQALNARKAELESAALNARLAAIENGGLHPVTRTIDRIESFFGELGFTVATGPEIEPGHHPARADHDT--------FWFDTTRLLRTQTSGVQIRTMKAQ-----QPPIRIIAPGRVYRNDYDQTHTPMFHQMEGLIVDTNISFTNLKGTLHDFLRNFFEEDLQIRPSYFPFTEPSAEVDKWLEVLGCGMVHPNVLRNVGIDPEGFAFGMGMERLTMLRYGVTDLRSFFENDLFLKQFK... 327
45 -28.9004p71_C mol:protein length:338 Phenylalanine--tRNA ligase alpha subunit  ali model follow..  16  32.......LGKKGELTQVMKTLGDLPAEERPKVGALINVAKEKVQDVLNARKTELEGAALAARLAAQLSGGLHPVTRTLERIEQCFSRIGYEVAEGPEVEPGHHPARAMHDT--------FYFNANMLLRTHTSPVQVRTMESQ----QPPIRIVCPGRVYRCDSDLT-HSPMFHQVEGLLVDEGVSFADLKGTIEEFLRAFSAEVDIQCVICSGNGCRVCKQTGWLEVMGCGMVHPNVLRMSNIDPEGFAFGMGAERLAMLRYGVNDLRLFFDNDLFLGQFR... 338
46 -28.5002du3_A mol:protein length:534 O-phosphoseryl-tRNA synthetase  ali model follow..  16  110..............................................................EKIRQIEAITKREVDSKPLQEIFHRYKKGEIDGDVLDVDDITAVKILDEVFPEFKELKPISSTLTLRSHMTTGWFITLSHIADKLPLPIKLFSIDRCFRREGEDATRLYTYFSASCVLVDEELSVDDGKAVAEALLRQFGTQTEVFAFHPKLVGSSTKYSDGWIEIATFGIYSPTALAEYDIPYPVMNLGLGVERLAMILYGYDDVRKMVYPQI......... 351
47 -27.2001efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model follow..  16  69.......VRAKGLVRLRPEPNPRLATGRVEVELSALEVLAEAKTPPFEKEASEELRLKYRYLDLRRRRENLRLRHRVIKAIWDFLDREGFVQVETPFL-----TKSTPEGARDFLVPYRHEPGLFYALPQSPQLFKQMLM------VAGLDRYFQIARCFRDEDLRADRQPDFTQLDLEMSFVE--VEDVLELNERLMAHV.................................................................................... 261
48 -26.4004rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  12  65..EFCVAVTGVVEVRPEGNENPEIPTGQIEVNATELTVLGESAPFQLDEQAGEEARLKYRYLDLRREGNALRLRSKVNAAARSVLAEHDFVEIETPTL-----TRSTPEGARDFLVPARLQPGSFYALPQSPQLFKQLLM------VAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMVEADDVIAISEQVLKAVWATIGYDLPLPLPRISYEEAMRRFGSDKPDL......................................................... 285
49 -26.3004wj3_M mol:protein length:599 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  14  60..FAKADRVRSEFVVKITGKVRLRPSGSIEVLGYELEVLNQAETPPFYSDVGEETRLRYRFIDLRRPEAKLKLRARITSSIRRYLDDNGFLDVETPIL-----GRPTPEGARDYLVPSRTYPGHFFALPQSPQLFKQLLM------VAGFDRYYQIAKCFRDEDLRADRQPEFTQIDIETLDESDIIGITEKMVRQLFKEV.................................................................................... 264
50 -25.8004o2d_A mol:protein length:620 Aspartate--tRNA ligase  ali model follow..  12  82...FCVAVTGVVEVRPEGNENPEIPTGQIEVNATELTVLGESAPFQLDEQAGEEARLKYRYLDLRREGNALRLRSKVNAAARSVLAEHDFVEIETPTL-----TRSTPEGARDFLVPARLQPGSFYALPQSPQLFKQLLM------VAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMVEADDVIAISEQVLKAVWATIGYDLPLPLPRISYEEAMRRFGSDKPDL......................................................... 301
51 -25.8005w25_A mol:protein length:616 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  13  75..LAQAHRLRAEFCVSVAGVVEEIATGEIEVNATSLTVLGECAPFQLDEPAGEELRLKYRYLDLRRDDAAIRLRSRVNAAARAVLARHDFVEIETPTI-----TRSTPEGARDFLVPARLHPGSFYAL-PQSPQLFKQLLM-----VAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMVDAEDIIAISEEVLTELWALI.................................................................................... 277
52 -25.6001eqr_A mol:protein length:590 ASPARTYL-TRNA SYNTHETASE  ali model follow..  15  57..LKLASELRNEFCIQVTGTVRARATGEIEVLASSLTIINRADPLDSNHVNTEEARLKYRYLDLRRPEQRLKTRAKITSLVRRFMDDHGFLDIETPML-----TKATPEGARDYLVPSRVHKGKFYALPQSPQLFKQLLM------MSGFDRYYQIVKCFRDEDLRADRQPEFTQIDVETSFMTA--PQVREVMEALVRHL.................................................................................... 255
53 -24.3004ah6_A mol:protein length:617 ASPARTATE--TRNA LIGASE, MITOCHONDRIAL  ali model follow..  13  65..KKILCEAPVESVVQVSGTVIKMPTGEIEIKVKTAELLNACKEIKNFVKKTEALRLQYRYLDLRSFQYNLRLRSQMVMKMREYLCNLGFVDIETPTL------FKRTPGGAKEFLVPSREPGKFYSLPQSPQQFKQLLM------VGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVDQ--TGIQSLIEGLLQYS.................................................................................... 265
54 -24.3004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  14  117...KFAANINKESIVDVEGVVRKVNQQDVELHVQKIYVISLAEPEEGRATVNQDTRLDNRVIDLRTSTAVFRLQSGICHLFRETLINKGFVEIQTPKIISAA-----SEGGANVFTVSYF--KNNAYLAQSPQLYKQMCICADFE------KVFSIGPVFRAEDSNHRHLTEFVGLDIEMAFNYHVMEEIADTMVQIFKGLQERFQTEIQTVNK-EALAMLREAGVEMGDEDDLSTPNEKLLGDTDFYILDKYPLAVRPYTMPDPRNPKQSNSYDMFMRGEEI.. 439
55 -23.9003ig2_A mol:protein length:213 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  17  7..........................................................................NKLQNLVAEQLVGCGFNEILNNSLTRAAYYDGLESYPSKNLVMLLNPLSADLCMRQTLLFGGLESIAHNANRKNADLKFFEFGNCYHFDAEKKNPYSEDYHLGLWVTGKMVSNSELKAYVENIFKRLGLDLHSLVVGNLS-TALTVNTKGGKRLATFGVVTKKMLKAFDVDNEVYYADLNWKEL........................... 212
56 -23.8003ica_A mol:protein length:213 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  17  7..........................................................................YKWQTVVSEQLVGAGFNEILNNSLTAGSYYEGLKSHPREMAVELMNPLSQELCMRQTLLFGGLETLSHNLRRKHLSLYLFEWGKCYRFHAAKRTDYAEDDRLGIWICGQRVHNSELKAVVEQVLCRVGIETGAYTLKTA--SAMEVKTRSGKLLGTFGTVSTELIKRFEIEQPVYFAELLWDAL........................... 212
57 -23.4001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  11  87..VKWAGSLNLESIVLVRGIVKKVDEPIKSATVQNLEIHITKAEAAGLPVVNLDTRLDYRVIDLRTVTAIFRIQAGVCELFREYLATKKFTEVHTPKLLGAP-----SEGGSSVFEVTYF--KGKAYLAQSPQFNKQQLIVADFE------RVYEIGPVFRAENSNTRHMTEFTGLDMEMAFEEHVLDTLSELFVFIFSELPKRFAHEIELVRKQYPVEEFKLPKDGKMVRLTYKEGIEMLRAAGDFYILDKFPLERPFYTMPDPANPKYSNSYDFFMRGEEI.. 412
58 -23.0001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  12  60..FKLIPKLRSEDVVAVEGVVNFTPKAKIVVLNRAETPLPLDPTGKVKAELDTRLNNRFMDLRRPEVMAIFKIRSSVFKAVRDFFHENGFIEIHTPKIIATA-----TEGGTELFPMKYF--EEDAFLAESPQLYKEIMMASGLD------RVYEIAPIFRAEEHNTRHLNEAWSIDSEMADEEEVMSFLERLVAHAINYVREHNAKELDILNFELEEPKLPFPRVSYDKALEILGDLGKEIPNAPLYFLYQYPSEAKPFIMKYDNKPEICRAFDLEYRGVEI.. 362
59 -22.5002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  14  55..TYDALTVNTECTVEIYGAIKEVPEGKEALIADFWKIIGNAPPGGIDNVLNEEASVDKMVIRGENAAALLRLRAAATRAMREHFYNAGYVEVAPPTLVQTQ-----VEGGSTLFNLDYF--GEQSFLTQSSQLYLETCIPTLG-------DVFCIAQSYRAEKSTRRHLAEYAHVEAECITLDDLMEKIEELVCDTVDRLLADEEAKKLEYKDAIKWLQEHNVENEFGNTFTYGEDIAEAAEINKPILLNRFPSEIKAFMQRDAKDNTLTESVDLLMPGVG... 359
60 -22.3001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  15  60..FEKAKKLGRESSVIVEGIVKADEPGGAEVHVEKLEVIQAVSEFPIPENPEQASPELLLDYRHL--SAIMKVKETLIMAAREWLLKDGWHEVFPPILVT-------GAVEGGATLFKLKYFDKYAYLSQSAQLYLEAAIFGLE-------KVWSLTPSFRAEKSRTRHLTEFWHLELEAAWMD--LWDIMKVEEELVSYM.................................................................................... 250
61 -22.2003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  11  73..PEKVKLLTRECSLEITGRLNAYAILNLEMQVTEWKVIGESLENIINKDSSIPQKMQNRHIVIRSEHQVLQLRSEIQWYFRKYYHDNHFTEIQPPTIVKTQ-----CEGGSTLFKLQYFNEPAYLTQSSQLYLESV---------IASLGKSFCMLSSYRAEQSRTRHLAEYLHLEAELISFEDLLNHLEDLVCTVIDNVMAVHGDKIRKMNPHLKLPTRPFKRMTYADAIKYCNDHGILNKIGCPIFMIHFPSKMKAFMSKVPGHPDLTESVDLLMPGVG... 378
62 -22.1001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  13  57..FGISQELTQESVIQVRGIVKADKRAEITLLSKAKAPLPLDVSGKVKADIDTRLRERVLDLRRQEMQAVIKIQSLALKAFRETLYKEGFIEIFTPKIIASAT---EGGAQLFPVIYF----GKEAFLAQSPQLYKELMAGVVE-------RVFEVAPAWRAEESDTFHLAEFISMDVEMADYNDVMQLLEKILHNIVKTIKEEGKEELKILNYEPPEVKIPIKRLKYTEAIEILRSKGYNIKKEDLYFIVDWPSDARPFTKSKSENPELSESFDLIYKFLEI.. 353
63 -22.1003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  13  171..FKKQEEDIAKVDEKIAKFLKDNEGKDLTKRPLKDEYAKLLKEKASAQKYVKVSQDTRLDNRMLTNIAIFRIQSACCGLFREFLTSQKFVEIHTPKLIGCS-----SEGGSNIFEVKYF--DRKAYLAQSPQLYKQMAIMGDFR------KVFEVGPVFRAENSNRRHLTEFEGLDIEMENYHECIDVMEKLFTFIFDEIPKRFPDELKVIRKQYPFEDLIYRPFLRLTYKEAIEMLRAAKYNTDFYILDKFPAAIRPFTMPDIDDPNYSNSYDVFVRGQEI.. 472
64 -22.1001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  10  45VVTGGLKLPLPESALRVRGLVVENAKGGLEVQAKEVEVLSPALEPKEEWRANPDTLLEYRYVTLRGEKAPLKVQAALVRGFRRYLDRQDFTEIFTPKVVR-------AGAEGGSGLFGVDYFEKRAYLAQSPQLYKQIMVGVFE-------RVYEVAPVWRMEEHTSRHLNEYLSLDVEMGDEEDLMRLEEALLAEMLEEALNTAGDEIRLLGATWPSFPQDIPRLTHAEAKRILKEELKERWGSDWLFVTRYPRSVRPFYTYP-EEDGTTRSFDLLFRGLEI.. 346
65 -22.0005xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  14  86...YNGVLLSTESSVAVYGMLNLTPKGKQALSCDFWELIGLAPAGGADNLINEESDVDVQMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQ-----VEGGATLFKLDYF--GEEAFLTQSSQLYLETCLPALG-------DVFCIAQSYRAEQSRRRHLAEYTHVEAECLTFDDLLNRLEDLVCDVVDRI-FKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIPEAPERLMTINEPILLCRFPVEIKSYMQRCPEDSRLTESVDVLMPN..... 386
66 -21.8002i4l_A mol:protein length:458 Proline-tRNA ligase  ali model follow..  18  1MGSSSSGLVPRGSHMRLSRFFLPILKENPKEAEIVSHRLMLRA----------MLRQEAAGIYAWLPLGHR-VLKKIEQIVREEQNRAGAIELLMPTLQLADLWRESGDAYGPEMLRIADRHKRELLYGPTNEEMITEIFRAYIKSYKSPLNLYHIQWKFRDEQRPRFRGREFLMKDAYSFDVDEAGARMFVAYLRTFARMGLKA................................................................................ 206
67 -21.8003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein  ali model follow..  21  12...................................................................YKAIDIQTKILDYMTKFFTDRGFKWLLPIMLSPITDPLWPDPAGEGIRPAEVDVYGVRMRLTHSMILHKQLAIAMGLE------KIFVLSPNIRLESRRKRHSYEFTQLDFEIAKMKDVMRLIEELIYGLFRKA--EFYDREENGVWKNYDLILPYGYGEVSSGGEREWEYEKRAGKLKPSAGAGIGVERLVRFIVGAKHIAEVQPF........... 284
68 -21.3004h2w_A mol:protein length:346 Amino acid--[acyl-carrier-protein] ligase 1  ali model follow..  15  5................SSGLVPRGSHMNIAVLPNSPDTAPQIADPLDHLADKLFHSMGSDGV--ARTALYESIVERLAALITS-HREAGTEALRFPPVMSRAQLEKSGSRFDAGGDWTTSLSPADLVLSPAACYPVYPIAASRGPLPKGGLRFDVAADCFRRESKHLDRLQSFRMREYVCIGTPDDVERWMVRAQAIARDLGLTFRVDYASDPFFGRAGKMLEQPTACMSFNYHREHFGTTWGIQDATGCVAFGMDRLAVAMFHTHGTD................ 312
69 -21.1001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  18  12...................................................................SPTLDIQTKILEYMTDFFVKEGFKWLLPVIISPITDPLWPDPAGEGMEPAEVEIYGVKMRLTHSMILHKQLAIAMGLK------KIFVLSPNIRLESRQKRHAYEFTQLDFEVAKMEDIMRLIERLVYGLFRKA-FEYSEVLEEFGSDEKASQEMEEPFEVASGGEREWEYEKKAGKLKPSAGAGIGVERLVRFIVGAKHIAEVQPFPRIPGIPAV.. 293
70 -21.0003mey_A mol:protein length:346 Bll0957 protein  ali model follow..  16  5................SSGLVPRGSHMNIAVLPNSPDTAPQIADPLDHLADKLFHSMGSDGV--ARTALYESIVERLAALITS-HREAGTEALRFPPVMSRAQLEKSGSRFDAGGDWTTSLSPADLVLSPAACYPVYPIAASRGPLPKGGLRFDVAADCFRRESKHLDRLQSFRMREYVCIGTPDFRERWMVRAQAIARDLGLTFRVDYASDPFFGRVLRSEEQPTACMSFNYHREHFGTTWGIQDATGCVAFGMDRLAVAMFHTHGTD................ 312
71 -19.5002j3l_A mol:protein length:572 PROLYL-TRNA SYNTHETASE  ali model follow..  14  2........................KQSKMLIPTLREVPNDAEVLSHQILLRAGYIRQVAAGIYSYLP---NRVLEKLKTIMREEFEKIDAVEMLMPALLPAELWKESGETYGPNLYRLKDRNDRDYILGPTHEETFTELIRDEINSYKRPLNLYQIQTKYRDEKRSRSRGREFIMKDGYSFHADQSYRDYEKAYSRIFERCGLEFRAIIGDGGAMGGKDSK................................................................ 208
72 -18.7005ucm_A mol:protein length:579 Proline--tRNA ligase  ali model follow..  17  2.............AMRTSQYLLSTLKETPADAVVISHQL----------LRAGMIRRLASGLYTWLP---LRVLRKVETIVREEMNAAGALEVLMPAVQPAELWQESGEQYGPELLRLKDRHEREFCVGPTHEEVITDLARNELNSYKQPINFYQIQTKFRDEIRPRFRGREFIMKDAYSFHLSQTYDGMYQAYSKIFSRLGLDFRPVQADNGSIGGSGSH................................................................ 210
73 -18.2004k86_A mol:protein length:535 Proline--tRNA ligase  ali model follow..  4.........SSSGLVPRGSHMASGAGEGQGPKKQTRLGLEAKKEENLADWYSQVEYHDISGCYILRPWAYA-IWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKVADFAPEVAWVTRLAEPIAIRPTSETVMYPAYAKWVQSHRDPIKLNQWCNVVRWEFKHP-RTREFLWQEGHSAEAAEEVLQILDLYAQVYEELLAIPVVK............................................................................. 224
74 -17.9003cmq_A mol:protein length:415 Phenylalanyl-tRNA synthetase, mitochondrial  ali model follow..  14  1................................MAAECATQRAPGSVVELLGKSYPQDDHSNLTRKLHNQQHHPLWLIKERVKEHFYKQYVGRFGTPLFSVYDNLSPVVTTWQNPADHPSRKKGDNYYLNRTHMLRAHTSAHQWDLLHAGLDAFLVVGDVYRRDQIDSQHYPIFHQLEAVRLAVKLVEFDLKQTLTRLMAHLFGD-IRWVDCYFPFTHPINFHGEWLEVLGCGVMEQQLVNSAGAQDRIWAFGLGLERLAMILYDIPDIRLFWCEDE......... 301
75 -17.8004hvc_A mol:protein length:519 Bifunctional glutamate/proline--tRNA ligase  ali model follow..  3.................SGEGQGPKKQTRLGLEAKKEENLADWYSQVITKSEMIEYHDISGCYILRPWAYA-IWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDPIKLNQWCNVVRWEFKHPQRTREFLWQEGHSAEAAEEVLQILDLYAQVYEELLAIPVVK............................................................................. 208

FFAS is supported by the NIH grant R01-GM087218-01
1 2 5 9 6 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24