current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 4cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .
# Score Template Links and tools%idFirst MPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLANYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNLLast
1 -127.0004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model  100  1MPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLANYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 268
2 -118.0004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  97  1.PALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMVAPNIFNYARKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFFQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCSVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 267
3 -116.0004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  99  19.PALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLGNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPRPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 285
4 -116.0003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  98  16.PALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLTPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLVFWQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSALVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 282
5 -114.0002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  98  19.PALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSGSYYNGISTNL 285
6 -114.0004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  98  19.PALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLSFIQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 285
7 -82.2002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  40  26.SFWTKVQYQRLKELNASGESDALSRDRAFQGIEHQLMSQGKRHLEQLRTVKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEDHPLFSQVFWLDGKKCLRPMLAPNLYTLWRELERLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEERRLEDMARWVLEAAGIEFELVTESSVVYGDTVDVMKGDLELASGAMGPHFLDEKWEIFDPWVGLGFGLERLLMIREGTQHVQSMARSLSYLDGVRLNI 301
8 -48.4003l4g_A mol:protein length:508 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  18  179.SAFSTSISKQETELSPEMISSGSWRDRPFKPYNFLAHGVLPDS-------GHLHPLLKVRSQFRQIFLEMGFTEMPTALFQPQQHPARDQHDTFFLRYNWKLDEARKNLLRTHTTSASARALYRLAQKKPFPVKYFSIDRVFRNETLDATHLAEFHQIEGVVADHGLTLGHLMGVLREFFTKLGITQLRFKPAYNPYTEPSMEVFKWVEVGNSGVFRPEMLLPMGLPESVIAWGLSLERPTMIKYGINNIRELVGHKVNLQMVYDS. 490
9 -39.2001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  14  2..................................YRLQIEKIRGFRDFYPEDMDVE-KFIFKTAEEAAEAFGFRRIDFPSLEYLDLYIKSGEELLQQTYSFVDKGGREVTLIPEATPSTVRMVTSR-KDLQRPLRWYSFPKVWRYEEPQAGRYREHYQFNADIFGSDSPEADAEALASSILDRLGLQYEIRINSRKIMEEIIGGMTSSDPFSVSIIDRYHKISREEFVDQLRSAGIGEDGVSMIADLCSGTRGIDEMARITGKSSEEI 239
10 -37.0002du3_A mol:protein length:534 O-phosphoseryl-tRNA synthetase  ali model follow..  15  2.....KFDPQKYRELAEKDFEAAWKAGKEILAERSPNELYPRVGF----SFGKEHPLFATIQRLREAYLSIGFSEVVNPLIVEDVHVKKQILDEVFPEFKELKPISSTLTLRSHMTTGWFITLSHIADKLPLPIKLFSIDRCFRREQGDATRLYTYFSASCVLVDEELSVDDGKAVAEALLRQFGFENFRFREKRSKYYIPDTQTEGWIEIATFGIYSPTALAEYDIPYPVMNLGLGVERLAMILYGYDDVRKMVYPQIHGEIKLSDL 360
11 -35.1003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  16  2.................AMGTLEAQTQGPGSMQKNMVETEPVQGCRDFPPEAMRC-RRHLFDVFHATAKTFGFEEYDAPVLESEELYRKAGEEITEQMFNFITKGGHRVALRPEMTPSLARLLLGKGRSLLLPAKWYSIPQCWRYEAITRGRRREHYQWNMDIVGVKSVSAEVECAACWAMRSLGLDVGIKVNSRKVLQTVVEQAGVTSDKFAPIVDKMEKIPREEVEAQLAVLGLEPTVVDAITTTLS................... 241
12 -34.8003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  16  2.................AMGTLEAQTQGPGSMQMNMVETEPVQGCRDFPPETMRL-RKYLFDVFHSTARKFGFEEYDSPVLESEELYRKAGEEITEQMFNFITKGGHRVALRPEMTPSLARQLLAKGRSLLLPAKWYSIPQCWRYEAITRGRRREHYQWNMDIIGVKSVSSEVECAACTAMQSLGLDVGVKINSRKILQTVVEQAGVSADKFAPIVDKMEKLPREEVVAQLAAIGLESNVVDAI........................ 236
13 -34.6001z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subu  ali model follow..  11  4..........................SGSIEGRMEKINYLLPEESAEMTLNQVKSL-RQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGKEKMFQFIKHEGQSITLRYDFTLPLVRLYSQIKD--STSARYSYFGKIFRKEKRHKGRSTENYQIGIELFGESADKSELESLALQVIEQLGLNKTVFEIGSAKFFQRLCQLADGST.......................................................... 190
14 -34.6002du7_A mol:protein length:549 O-phosphoseryl-tRNA synthetase  ali model follow..  13  8.DDKMRFDIKKVLELAEKDFE-TAWRETRALIKDKHIDNKYP---RLKPVYGKPHPVMETIERLRQAYLRMGFEEMINPVIVDEMEIYKQFGPEAMAVLDRCFYLATTLTLRSHMTSGWFITLSSLIKKRKLPLKLFSIDRCFRREQRDRSHLMSYHSASCVVVGEDVSVDDGKVVAEGLLAQFGFTKFKFKEKKSKYYTPETQTEEWIEVATFGVYSPIALAKYNIDVPVMNLGLGVERLAMIIYGYEDVRAMVYPQFYEYRLS... 361
15 -33.9001qe0_A mol:protein length:420 HISTIDYL-TRNA SYNTHETASE  ali model follow..  15  1.....................................MIKIPRGTQDILPEDSKKW-RYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSTDVVQKEMYKGDRSITLRPEGTAAVVRSYHKMQGNPNQPIKLYYNGPMFRYERKQKGRYRQFNQFGVEAIGAENPSVDAEAMVMHIYQSFGLKHLKLVINSVGDMASRKEYNEALEFCSDCQSRLHT-DPMRI-KVDRDKEAIKTAPRITDFLNEESKAYYEQKAYLDDLGIP. 248
16 -33.6004rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  17  2...................................PMTARAVRGTKDLFGKELRMH-QRIVATARKVLEAAGALELVTPIFEETQVFEKGVGAATDIVRKEMFRGGRSLTLRPEGTAAMVRYLEHGMKVWPQPVRLWMAGPMFRAERPQKGRYRQFHQVNYEALGSENPILDAEVLLYECLKELGLRRLKVKLSSVGDPEDRARYNAYLALSEDSKERLEL-NPMRISERDQALLKELGVRPMLDFLGEEARAHLKEERHLERLSVP. 252
17 -30.6001b70_A mol:protein length:350 PHENYLALANYL-TRNA SYNTHETASE  ali model follow..  17  33.....TQEMKGLSALPLEERRKRGQELNAIKAALEAALEAREKALEEAALKEALHPITLMERELVEIFRALGYQAVEGPEVEPEHHPARDMWDTFWLTGEGFEEVEGRLLLRTHTSPMQVRYMVAH----TPPFRIVVPGRVFRFEQTDATHEAVFHQLEGLVVGEGIAMAHLKGAIYELAQAL--SKVRFQPVYFPFVEPGAQFAKWLELGGAGMVHPKVFQAVDAYRE-FAFGLGVERLAMLRYGIPDIRYFFGGRLKF....... 342
18 -30.2004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  13  18..............................EQKRKLEKLTGVKGMNDILPQDAGLW-EFFEATVKSLLRAYGYQNIRTPIVEHTPLFTRGIGEVTDIVEKEMYSNGENLTLRPENTAAVVRAAIEHNMLYDGPKRLWYIGPMFRHERPQRGRYRQFHQVGVEALGFAGPDADAEMMCQRLWEDLGLTGIKLEINSLGLAEERAAHRVELKLDDDAQRRLYTNPLRVLDTKNPALQEIVRNAPKLIDFLGD-----VSRAHFEGLQRLL 265
19 -30.1002rhq_A mol:protein length:294 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  17  1MGSSSSGLVPRGSHMGTELMEKLNQQLAE-ETIDVTLPSRQIS-------IGSKHPLTRTVEEIEDLFLGLGYEIVDGYEVEPKSHPARDMQDS--------FYITDEILMRTHTSPVQARTMEK--RNGQGPVKIICPGKVYRRDSDDATHSHQFTQIEGLVVDKNIKMSDLKGTLELVAKKL--REIRLRPSYFPFTEPSVEVDGWIEILGAGMVHPNVLEMAGFDSNEFAFGMGPDRIAMLKYGIEDIRYFYTNDVRF....... 276
20 -29.0002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  14  4..............................YQDPMAKNIQAIRGMNDYLPGETAIW-QRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYRNGDSLTLRPEGTAGCVRAGIEHGLLYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDIDAEMLTARWWRALGISEHVTLEARANYRDALVAFLEQ-KLDEDCKRRMYTNPLRVLDSKNPEVQALLNDAPALGDYLDE-----ESREHFAGLCKLL 251
21 -28.5005e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  15  7.......................................VAIKGFNDVLPTQTAAW-RRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRAIGDATDIVEKEMYTPPESLTLRPEGTAGCVRALVEHNLLRGATPRVWYMGPMFRYEKPQKGRYRQFHQFGVETFGVATPDIDAEMLTARLWKRMGVDHMVQTDERTEYRNALVAFLNE-ALDEDSQRRLTTNPLRILDSKIESTQKILENAPKLHDFLKE-----DSLSHFQQLQDYL 247
22 -28.3003od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subu  ali model follow..  13  2..............................NAMSKPFMFEKPFGMRDTLPEWYKT-KKNICDQMTEEINLWGYDMIETPTLEYYETVGVVSAILDQQLFKLLDQQGNTLVLRPDMTAPIARLVASSLKDRAYPLRLAYQSNVYRAQQNEGGKPAEFEQLGVELIGDGTASADGEALMIAALKRAGLEFKVAIGHVGYVNALLMDVVGNEQRADRLRRFLYEKNYVGYREHVKSLNLSTIDKSRLMN-IEEARGLIQTEKGKTALA... 247
23 -28.2003pco_A mol:protein length:327 Phenylalanyl-tRNA synthetase, alpha subunit  ali model follow..  18  39.....TLQMTTLRELPPEERPAAGAVINEAKEQVQQALNARKAELESAALNARLHPVTRTIDRIESFFGELGFTVATGPEIEPGHHPARADHDT--------FWFDTTRLLRTQTSGVQIRTMKAQ----QPPIRIIAPGRVYRNDY-DQTHTPMFHQMEGLIVDTNISFTNLKGTLHDFLRNF---QIRFRPSYFPFTEPSAEVDKWLEVLGCGMVHPNVLRNVGIDPE-FAFGMGMERLTMLRYGVTDLRSFFENDLRF....... 322
24 -27.9003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  15  18.................................AVRGFADRPPGMQDGYPDFAKR-RRAVETRLLSFVEDAGYEPVTSGLFEYVDTLLRRSPESSRDWIRLFDGGGDAVALRPEMTPSIARMAAPRVAAGRTPIRWCYCERVYRRTDDPSGKAAESTQVGIERIGEEASVDDVLRLLHEASAAAGVHHRIVVSHARLVPRLLDALGISASLSRAFLACLTSGNYVQFRE....................................... 223
25 -27.3003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  14  7.................................NDKINFSTPSGFPEFLPSEKRL-ELYLLDTIRRVYESYGFTPIETPAVERLEVLQAKGNQGDNIIYGSGDTGSEARALKFDQTVPLAAYIARHLNDLTFPFARYQMDVVFRGERAKDGRFRQFRQCDIDVVGREKYDAQMPAIITEIFEAVNIGDFVIRINNTGFFQSLNISETQIKSCISIIDNLEKIGEAKVKLELEKEGINPEQTQKIIDFVKIDGSVDDVLDKLKHLSQTL 263
26 -26.8004p71_C mol:protein length:338 Phenylalanine--tRNA ligase alpha subunit  ali model follow..  18  39.....TQVMKTLGDLPAEERPKVGALINVAKEKVQDVLNARKTELEGAALAARLHPVTRTLERIEQCFSRIGYEVAEGPEVEPGHHPARAMHDT--------FYFNANMLLRTHTSPVQVRTMESQ----QPPIRIVCPGRVYRCDS-DLTHSPMFHQVEGLLVDEGVSFADLKGTIEEFLRAF--LEVRFRPSFFPFTEPSAEVDGWLEVMGCGMVHPNVLRMSNIDPEKFAFGMGAERLAMLRYGVNDLRLFFDNDLRF....... 333
27 -24.5003g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  18  15...................................................PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPFETRFVGPGHSQGINLYLMTSPEYHMKRLLAAGCG------PVFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDMYMNEVDDLLQQVLDCQPAESLSYQQAFQRHLEIDPLSADKTQLREAALFTMGVEPHIGKEKPTFIYHFPASQASLAQISTEDHRVAERFEVYYKGIEL.. 246
28 -24.3003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  17  28...................................................PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGPGHSQGMNLWLMTSPEYHMKRLLVAGCG------PVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPLSADKTQLREVALFTFGVEPNIGKEKPTFVYHFPASQASLAQISTEDHRVAERFEVYYKGIEL.. 259
29 -23.5004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  16  6..............................FELRRQFVLKTPKGTRDYSPRQMA--REKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYL---AMNKLTNIKRYHIAKVYRRDNPTRGRYREFYQCDFDIAGNFDPMAECLKIMCEILSSLQIGDFLVKVNDDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVG-GLAPEVADRI........................ 225
30 -23.0004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  17  18LEELVKLQGERVRGLKQQKASAELIEEEVAKESKQKFVLKTPKGTRDYSPRQMA--REKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYL---AMNKLTNIKRYHIAKVYRRDNPTRGRYREFYQCDFDIAGNFDPMAECLKIMCEILSSLQIGDFLVKVNDDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVG-GLAPEVADRI........................ 278
31 -22.3001usy_A mol:protein length:275 ATP PHOSPHORIBOSYLTRANSFERASE REGULATORY SUBU  ali model follow..  14  7..........................................................EKVFSFYSKATKKGFSPFFVPALEKAEEPA---------GNFFLDRKGNLFSIREDFTKTVLNHRKRYSP--DSQIKVWYADFVYRYSG---SDLVAEYQLGLEKVPRNSLDDSLEEIIVESASEFFEPVIVEIGHTGVYEDLLKEIPKDLH-TKNLAEIEFLSHMKKIDLSRVEKIIEDSIYRRSPEHLKTMDLPLSVREDLLSASSFL 212
32 -22.2003ig2_A mol:protein length:213 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  17  7.........................................................NKLQNLVAEQLVGCGFNEILNNSLTRAAYYDGLESYPSKNLVMLLNPLSADLCMRQTLLFGGLESIAHNANRKNADLKFFEFGNCYHFDAEKKNPYSEDYHLGLWVTGKMVSNSELKAYVENIFKRLGLDLHSLVVGNL--TALTVNTKGGKRLATFGVVTKKMLKAFDVDNEVYYADLNWKELM.......................... 213
33 -21.5003ica_A mol:protein length:213 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  17  7.........................................................YKWQTVVSEQLVGAGFNEILNNSLTAGSYYEGLKSHPREMAVELMNPLSQELCMRQTLLFGGLETLSHNLRRKHLSLYLFEWGKCYRFHAAKRTDYAEDDRLGIWICGQRVHNSELKAVVEQVLCRVGIETGAYTLKTA--SAMEVKTRSGKLLGTFGTVSTELIKRFEIEQPVYFAELLWDALM.......................... 213
34 -20.8003mey_A mol:protein length:346 Bll0957 protein  ali model follow..  14  1MGSSSSGLVPRGSHMNIAVLPNSPDTAPQIADPLDHLADKLFHSMGSDGVYARTALYESIVERLAALITEAGTEALRFPPVMSRAQLEKSGSRFDAGGDWTTSLSPADLVLSPAACYPVYPIAASRGPLPKGGLRFDVAADCFRRESKHLDRLQSFRMREYVCIGTPDDVERWMVRAQAIARDLGLTFRVDYASDPFFGRPLRSEEQPTACMSFNYHREHFGTTWGIQDATGCVAFGMDRLAVA........................ 304
35 -20.8003cmq_A mol:protein length:415 Phenylalanyl-tRNA synthetase, mitochondrial  ali model follow..  14  2......AAECATQRAPGSVVELLGKSYPQDDHSNLTRKVLTRVGRN--LHNQQHHPLWLIKERVKEHFYKQYVGRFGTPLFSPADHPSRKKGDN--------YYLNRTHMLRAHTSAHQWDLLHA------GLDAFLVVGDVYRRDQIDSQHYPIFHQLEAVRLAVKLVEFDLKQTLTRLMAHL---EIRWVDCYFPFTHPSFEMEEWLEVLGCGVMEQQLVNSAGAQDRI-AFGLGLERLAMILYDIPDIRLFWCEDERF....... 303
36 -20.7004h2w_A mol:protein length:346 Amino acid--[acyl-carrier-protein] ligase 1  ali model follow..  14  1MGSSSSGLVPRGSHMNIAVLPNSPDTAPQIADPLDHLADKLFHSMGSDGVYARTALYESIVERLAALITEAGTEALRFPPVMSRAQLEKSGSRFDAGGDWTTSLSPADLVLSPAACYPVYPIAASRGPLPKGGLRFDVAADCFRRESKHLDRLQSFRMREYVCIGTPDDVERWMVRAQAIARDLGLTFRVDYASDPFFGRPLRSEEQPTACMSFNYHREHFGTTWGIQDATGCVAFGMDRLAVA........................ 304
37 -17.7003l4g_B mol:protein length:589 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  15  378.........................................QMTLPKTYTIANQFPLNKLTELLRHDMAAAGFTEALTFALCSQEDIADKLISATKAVHISNPKTAEFQVARTTLLPGLLKTIAANRKM-PLPLKLFEISDIVIKDSNTDVGAKNYRHLCAVYYNKNPGFEIIHGLLDRIMQLLDVPPGEDKGGYVI-GRCAEIFARGQSVGKLGVLHPDVITKFELTMPCSSLEINIGPFL.......................... 589
38 -16.7003w3s_A mol:protein length:527 Type-2 serine--tRNA ligase  ali model follow..  20  221........................................................MAALFEVLRDFLLELGFEPALFPKLIPLETMFRMRYELFDDFKRELYVWGEGYVLAPAQCEPFYELLREVVDPERLPIKLYDCGWTYRWEGKGLERVNEFQRIEHVWIAEPEEARELLEATKRVAEELELEWKVVVSDDPFYLEGRLLEDRDIELPDVPSYEFEVYLPFKGERSSEEAGLGVTRWVVG........................ 489
39 -16.0001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  23  19.........................................................TKILEYMTDFFVKEGFKWLLPVIISPDPLWPDPAGEGMEPAEVEIYGVKMRLTHSMILHKQLAIAMG----------KIFVLSPNIRLESRQKDHAYEFTQLDFEV--ERAKMEDIMRLIERLVYGLGYGEVASGGEREWEYEKIVAKIRKAGLNEDSFRPYLEIAKAGKLKPSAGAGIGVERLVRFIVGAKHIAEV.............. 281
40 -16.0003a74_A mol:protein length:493 Lysyl-tRNA synthetase  ali model follow..  18  145...........................EKYHGLKDIEQRYRQRYLDLIMNPESKKTFSLIIQSMRRYLDSHGYLEVETPMMHAV-----AGGAAARPFITHHNALDMTLYMRIAIELHLKRLIVGGLE------KVYEIGRVFRNEGISTRHNPEFTMLELYE--AYADFRDIMKLTENLIAHIATE................................................................................. 294
41 -15.8001bbu_A mol:protein length:504 PROTEIN (LYSYL-TRNA SYNTHETASE)  ali model follow..  22  154...........................DKFHGLQDQEARYRQRYLDLISNDESRNTFSQILSGIRQFMVNRGFMEVETPMMQVIP-----GGAAARPFITHHNALDLDMYLRIAPELYLKRLVVGGFE------RVFEINRNFRNEGISVRHNPEFTMMELYM--AYADYKDLIELTESLFRTLAQD................................................................................. 303
42 -15.8001e1o_A mol:protein length:504 LYSYL-TRNA SYNTHETASE, HEAT INDUCIBLE  ali model follow..  20  154...........................DKFHGLQDQEVRYRQRYLDLIANDKSRQTFSKILAAIRQFMVARGFMEVETPMMQVIP-----GGASARPFITHHNALDLDMYLRIAPELYLKRLVVGGFE------RVFEINRNFRNEGISVRHNPEFTMMELYM--AYADYHDLIELTESLFRTLAQE................................................................................. 303
43 -15.8003bju_A mol:protein length:521 Lysyl-tRNA synthetase  ali model follow..  19  147...........................HLHFGLKDKETRYRQRYLDLILNDFVRQKFSKIITYIRSFLDELGFLEIETPMMNII-----PGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGID------RVYEIGRQFRNEGIDLTHNPEFTTCEFYM--AYADYHDLMEITEKMVSGM.................................................................................... 293
44 -15.6003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related  ali model follow..  23  19.........................................................TKILDYMTKFFTDRGFKWLLPIMLSPITDPLWPDPAGEGIRPAEVDVYGVRMRL------THSMILHKQLAIAMGLEKIFVLSPNIRLESRRKDHSYEFTQLDFEI--EGAKMKDVMRLIEELIYGLGYGEVSSGGEREWEYEKIVAKIRAAGLKEDSFRPYLEIARAGKLKPSAGAGIGVERLVRFIVGAKHIAEV.............. 281
45 -15.5001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  20  89.....EILPEKIVVLNRAETPLPLDPTGKVKAELDTRLNNRFMDLRRPEVMAIFKIRSSVFKAVRDFFHENGFIEIHTPKII-----ATATEGGTELFPMKYFEEDAFLAESPQ--------LYKEIMMASGLDRVYEIAPIFRAEEHNTRHLNEAWSIDSE-MAFIEDEEEVMSFLERLVAHA---YIMKYDNKPEICRAFDLEYRGVEISSGGQREHRHDKEKGLNPESFGFGLGAERLIKQMLDLPNIREV.............. 426
46 -15.5004up7_A mol:protein length:777 LYSINE--TRNA LIGASE  ali model follow..  20  145...........................SMHYGLGDQETRFRKRYLDLIVNPESVKNFTKVVKAVRKYLDDKGFLEVETPILNTI-----PGGATARPFITHHNQLDIQMYMRIAPELYLKELVVGGIN------RVYEIGRLFRNEGIDQTHNPEFTTCEFYM--AYADYNDIMKMTEELLGNM.................................................................................... 291
47 -15.4004ex5_A mol:protein length:529 Lysine--tRNA ligase  ali model follow..  21  169...........................DKFHGLADQETRYRQRYVDLIVTPETRTTFTKAIASIRKFMGDADFMEVETPMLHPIP-----GGAAAKPFVTHHNALDMEMFLRIAPELYLKRLIVGGFE------RVFEINRNFRNEGVSPRHNPEFTMMEFYA--AYTDYRWLMDFTERLIRQAAVD................................................................................. 318
48 -15.4001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  16  86.....ELHAEEITLLSKAKAPLPLDVSGKVKADIDTRLRERVLDLRRQEMQAVIKIQSLALKAFRETLYKEGFIEIFTPKIIASATEGGAQLFPVIYFGKEAFLAQSPQLYKELMAGVV---------------RVFEVAPAWRAEESDTFHLAEFISMDVEMADYNDVMQLLEKILHNIVKTIKEEYTKSKSENPELSESFDLIYKFLEIVSGST--EEALKKKGLKPPHAGFGMGLARLMVMLTGIQSVKEI.............. 417
49 -15.2004ycv_A mol:protein length:516 Lysine--tRNA ligase  ali model follow..  21  153.......................KDTEIRYRQRYLDLLINES-------SRHTFVTRTKIINFLRNFLNERGFFEVETPMMNLI-----AGGANARPFITHHNDLDLDLYLRIATELPLKMLIVGGID------KVYEIGKVFRNEGIDNTHNPEFTSCEFYW--AYADYNDLIKWSEDFFSQL.................................................................................... 293
50 -15.0004hwo_A mol:protein length:411 Threonine--tRNA ligase  ali model follow..  17  36.........................................................RELEVFVRSKLKEYQYQEVKGPFMMDRVLWEKTGHDNYKDAMFTTSSENREYCIKPMNCPGHVQIFNQGLKSYRDPLRMAEFGSCHRNEPSGSLHVRGFTQDDAHIIGSDEMWDRAEADLAVALEENNIPFEYQLGEGAFYGPKIEFTLYDCRAWQCGTVQLDFSLPSRLSASYVGEDNERKVPVMIH------RAILGSMERFIGILTE. 288
51 -14.8003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  19  196.....DLTKRPLKDEYAKLLKEKASAQKYVKVSQDTRLDNRMLDLRTVTNIAIFRIQSACCGLFREFLTSQKFVEIHTPKLI-----GCSSEGGSNIFEVKYFDRKAYLAQSPQ--------LYKQMAIMGDFRKVFEVGPVFRAENSNTRHLTEFEGLDIE-MEIVENYHECIDVMEKLFAKYNTDFYILDIDDPNYSNSYDVFVRGQEITSGAQ--MKRCIEKGVDPATLGCGIGLERITMLYLGIPNIRKV.............. 536
52 -14.6003a31_A mol:protein length:471 Probable threonyl-tRNA synthetase 1  ali model follow..  15  1...MASGQDKTHIDYA-YELDITVKPDSRVPVFNREFATFTGAGVPLFSLGGGP--RYALAEVLAKFHARRGYYVVETPIIASTELFKVSGHEFYRNNMYLFDIEGHEFAVKPMNCPYHILLFLNEVAKHRSPFKVFEFGRVHRYEPSGSIYVRGFTQDDAHIIVPGGRVIEEMKLVLERLFKLGVSSETFK............................................................................ 203
53 -14.5001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  19  76.....EVQAKEVEVLSPALEPTPVEIPKEEWRANPDLLEYRYVTLRGEKARAPLKVQAALVRGFRRYLDRQDFTEIFTPKVVRAGAEGGSGLFGVDYFEKRAYLAQSPQLYKQIMVGVFE--------------RVYEVAPVWRMEEHHTRHLNEYLSLDVE-MGFIADEEDLMRLEEALLAEMGSDWLFVYPEEDGTTRSFDLLFRGLEITSGGQ--LESLKAKGMDPEAFGFAIGAERLTQKLLGLPNVRYA.............. 410
54 -14.4002cim_A mol:protein length:522 SERYL-TRNA SYNTHETASE  ali model follow..  14  155....KNRVPDRILTLLEEKIEAAQYGAKAEHWNLLWQREPMEHPFKEDPTQAMMK-SARIFRTFEKIVLELGYREMIFPKLVTWEVWMKSGTHEVPTKLIKEKIAEPIGGMCYAQCPPFWMYVAGETLPNEEPVKVFDRGTSHRYESHGIERVDEFHRIEIVWIGTKEEVLKLHDRYMHIFNDILDIEWRKARVTPWFMAQEGLLGEWLEFQNVSINGDKYPKGFNVKLQ---SGVGLERWAAVQKGLDPANWPEEFRNRVGEMPKGI 513
55 -14.3002i4l_A mol:protein length:458 Proline-tRNA ligase  ali model follow..  14  10....PRGSHMRLSRFFLPILKENPKEAEIVSHLRAGMLRQEAAGIYAWLPLGHR--LKKIEQIVREEQNRAGAIELLMPTLQLADLWRESGDAYGPEMLRIADRHKRELLYGPTNEEMITEIFRAYIKSYKSPLNLYHIQWKFRDERFGVMRGREFLMKDAYSFDVDEAGARMFVAYLRTFARMGLKAIPMRAETGPIGGDLS................................................................. 221
56 -14.0001nyq_A mol:protein length:645 threonyl-tRNA synthetase 1  ali model follow..  16  224..........DKKELKAHLQMLEERKERDHRKIGKELSQLVGAGLPLWLPNGAT--RREIERYIVDKEVSMGYDHVYTPVLANVDLYKTSGH-QEDMFPPMQLDETESMVLRPMNCPHHMMIYANKPHSYREPIRIAELGTMHRYEASGAQRVRGMTLNDSHIFDDDDMWNKAENMLKEAADELGLSYEEAIGEAAFYGPKLDVQVKTAMGKEETLSTAQLD-PERFDLTYIGQDGEHHRPVVIHRGV.................... 520
57 -13.9001qf6_A mol:protein length:642 THREONYL-TRNA SYNTHETASE  ali model follow..  14  218IYGTAWADKKALNAYLQRLEEAAKRDHRKIGKQLDLYHMQEEAPGMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRVLWEKTGHDNYKDAMFTTSSENREYCIKPMNCPGHVQIFNQGLKSYRDPLRMAEFGSCHRNEPSGSLHVRGFTQDDAHIIGSDEMWDRAEADLAVALEENNIPFEYQLGEGAFYGPKIEFTLYDCRAWQCGTVQLDFSLPSRLSASYVGEDNERKVPVMIH------RAILGSMERFIGILTE. 527
58 -13.9004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  19  173................AVRPEAEGEEEGRATVNQDTRLDNRVIDLRTSTSQAVFRLQSGICHLFRETLINKGFVEIQTPKII-----SAASEGGANVFTVSYFKNNAYLAQSPQ--------LYKQMCICADFEKVFSIGPVFRAEDSNTRHLTEFVGLDIE-MAFNYHYHEVMEEIADTMVQIGVEYTMPDPRNPKQSNSYDMFMRGEEILSGAQ--TERALHHGIDLEKIGGGIGLERVTMLFLGLHNVRQT.............. 503
59 -13.8004p3n_A mol:protein length:415 Threonine--tRNA ligase, cytoplasmic  ali model follow..  17  1...................MGSSSSGDHR-RDQELYFFHELSPGSCFFLPKGAY--YNALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFSFEVEKEFALKPMNCPGHCLMFDHRPRSWREPLRLADFGVLHRNELSGATRVRRFQQDDAHIFCAMEQIEDCLDFLRTVYSVFGFSFKLNLSTR......................................................................... 187
60 -13.7004hwt_A mol:protein length:413 Threonine--tRNA ligase, cytoplasmic  ali model follow..  17  10..............................RDQELYFFHELSPGSCFFLPKGAY--YNALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFSFEVEKEFALKPMNCPGHCLMFDHRPRSWREPLRLADFGVLHRNELSGATRVRRFQQDDAHIFCAMEQIEDCLDFLRTVYSVFGFSFKLNLSTR......................................................................... 183
61 -13.5004rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  19  90..........QIEVNATELTVLGESAPLPFQ--EEARLKYRYLDLRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTLTRST------------------EGARDFLVPARLQPGSFYALPQSPQLFKQLLRYYQIARCYRDEDFRADRQPEFTQLDMEMVEADDVIAISEQVLKAVWATIGYD---------------------LPLPLPRISYEEAMRRFGSDKPDLRFGIELVECTEYFKDTT................... 302
62 -13.4001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  16  127IYTISETPEALPILLEDASRSEAEAEAAGLPVVNLDTLDYRVIDLRTVTNQAIFRIQAGVCELFREYLATKKFTEVHTPKLL-----GAPSEGGSSVFEVTYFKGKAYLAQSPQ--------FNKQQLIVADFERVYEIGPVFRAENSNTRHMTEFTGLDME-MAFEEHYHEVLDTLSELFVFIGKEYTMPDPANPKYSNSYDFFMRGEEILSGAQ--QERMKAHGLSPPHAGGGIGLERVVMFYLDLKNIRRA.............. 478
63 -13.4004o2d_A mol:protein length:620 Aspartate--tRNA ligase  ali model follow..  19  106..........QIEVNATELTVLGESAPLPFQ--EEARLKYRYLDLRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTLTRST------------------EGARDFLVPARLQPGSFYALPQSPQLFKQLLRYYQIARCYRDEDFRADRQPEFTQLDMEMVEADDVIAISEQVLKAVWATIGYD---------------------LPLPLPRISYEEAMRRFGSDKPDLRFGIELVECTEYFKDTT................... 318
64 -13.1003ugq_A mol:protein length:460 Threonyl-tRNA synthetase, mitochondrial  ali model follow..  13  1...MGSSSSGLVPRGSHMASATKNASSAT-QRQDLFMTDPLSPGSMFFLPNGAKIFNKLIEFMKLQQKFKFGFNEVVTPLIYKKTLWEKSGHWENYADDMFKVETKEEYGLKPMNCPGHCLIFGKKDRSYNEPLRFSDFSPLHRNEASGATRLRKFHQDDGHIIGDLKVWNHAEQVLKEILEESGKPWKLNPGDGAFYGPKLDIMVTDHKTHQVATIQLDFQLPERFDLKFKDQDNSYKRPIMIH------RATFGSIERFMALLID. 327
65 -12.8002j3l_A mol:protein length:572 PROLYL-TRNA SYNTHETASE  ali model follow..  17  2..KQSKMLIPTLREVPNDAEVLSHQ-------LRAGYIRQVAAGIYSYLPLANR--LEKLKTIMREEFEKIDAVEMLMPALLPAELWKESGETYGPNLYRLKDRNDRDYILGPTHEETFTELIRDEINSYKRPLNLYQIQTKYRDERSGLLRGREFIMKDGYSFSLDQSYRDYEKAYSRIFERCGLEFRAIIGDGGAMG..................................................................... 203
66 -12.6001wle_A mol:protein length:501 Seryl-tRNA synthetase  ali model follow..  16  155VPVGDESQARVLHVVGDKPAFSFQPRGEKLDIIRQKRLSHVSGHRSYYLRGAGALLQHGLVNFTLNKLIHRGFTPMTVPDLLRGVVFEGCGMAKPSQIYNIDPSRFEDLNLAGTAEVGLAGYFMHSVAFRDLPIRMVCSSTCYRAETDTGKRVHHFTKVEMFGVQSSELLEEFLSLQMEILTELGLHFRVLDPGRGRFGEVTSASNTDFQSRRLHIMFQTEAGELQFAHTVNATGCAVPRLLIA---LESYQQKDGSVLVPPALQ... 459
67 -12.6001efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model follow..  17  109..................PVDAGWRGEEEKEASEELRLKYRYLDLRRRRMQENLRLRHRVIKAIWDFLDREGFVQVETPFLTKST------------------EGARDFLVPYRHEPGLFYALPQSPQLFKQMLRYFQIARCFRDEDLRADRQPDFTQLDLEM--SFVEVEDVLELNERLMAHV-----------------REALGVELPLPFPRLSYEEAMERYGSDKPDLRFGLELKEVGPLFRQSG................... 310
68 -12.4001eqr_A mol:protein length:590 ASPARTYL-TRNA SYNTHETASE  ali model follow..  16  91..........EIEVLASSLTIINRADVLPLDS-EEARLKYRYLDLRRPEMAQRLKTRAKITSLVRRFMDDHGFLDIETPMLTKAT------------------EGARDYLVPSRVHKGKFYALPQSPQLFKQLLRYYQIVKCFRDEDLRADRQPEFTQIDVETMTAPQVREVMEALVRHLWLEV-FPVMTFAEAERRYGSDKPDLRNPMELTD--VADLLKSVEFAVFAGPANDPKGRVAALRVPGGASLTRKQIDEYGNFVKI.... 343
69 -12.4004wj3_M mol:protein length:599 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  14  90MASGSIEVLGYELEVLNQAETPPFPLDEYSDVGEETRLRYRFIDLRRPEMAAKLKLRARITSSIRRYLDDNGFLDVETPILGRPT------------------EGARDYLVPSRTYPGHFFALPQSPQLFKQLLRYYQIAKCFRDEDLRADRQPEFTQIDIETLDESDIIGITEKMVRQLFKEV-FPHMPFEEAMRRYGSDKPDLRIPLELVD--VADQLKEVEFKVFSGPANDPKGRVAALRVPGAASMPRSQIDDYTKFVGI.... 348
70 -12.2004ah6_A mol:protein length:617 ASPARTATE--TRNA LIGASE, MITOCHONDRIAL  ali model follow..  17  95MPTGEIEIKVKTAELLNACKKLPFEIKNFVKKTEALRLQYRYLDLRSFQMQYNLRLRSQMVMKMREYLCNHGFVDIETPTLF------KRTPGGAKEFLVPSREPGKFYSL-----PQSPQQFKQLLMVGG---RYFQVARCYRDEGSRPDRQPEFTQIDIEM--SFVDQTGIQSLIEGLLQYS-----------------WPNDKDPVVVPFPTMTFAEVLATYGTDKPDTRFGMKIIDISDVFRNTE................... 313
71 -12.1003lsq_A mol:protein length:484 Seryl-tRNA synthetase  ali model follow..  17  186................................MDTSKAVTSMAGGRSYVLKGGLVQLQVLVSYSLDFLVKRGYTPFYPPFFLNRDVMGEVAQQFDEELYQVSGDGDKKYLIATSEMPIAAYHRGRWFTELKEPLKYAGMSTCFRKEAGAHGRVHQFDKIEQFVVESWRHLEDMITTSEEFNKSLGLPYRVVN............................................................................ 361
72 -11.7001ser_A mol:protein length:421 PROTEIN (SERYL-TRNA SYNTHETASE (E.C.6.1.1.11)  ali model follow..  13  172...........................................................LLRFAMDFMARRGFLPMTLPSYAREKAFLGTGHFPAYRDQVWAIAETDLYLTGTAEVVLNALHSGEILPYEALPLRYAGYAPAFRSEAGSFGRVHQFHKVEQYVLASDRAFQELLENAEEILRLLELPYRLVEPSEGRYRETHSSALLDWQARRANLRYRDPEGRVRYAYTLNNTALATPRILAM---LENHQLQDGRVRVPQALI... 409
73 -11.3003err_A mol:protein length:536 fusion protein of microtubule binding domain  ali model follow..  13  281...........................................................LLRFAMDFMARRGFLPMTLPSYAREKAFLGTGHFPAYRDQVWAIAETDLYLTGTAEVVLNALHSGEILPYEALPLRYAGYAPAFRSEAGSFGRVHQFHKVEQYVLASDRAFQELLENAEEILRLLELPYRLVEPSEGRYRETHSSALLDWQARRANLRYRDPEGRVRYAYTLNNTALATPRILAM---LENHQLQDGRVRVPQALI... 518
74 -11.2002dq0_A mol:protein length:455 Seryl-tRNA synthetase  ali model follow..  13  199...........................................................LIRFALDRLIEKGFTPVIPPYMVRRFVEEGSTSFEDFEDVIYKVEDEDLYLIPTAEHPLAGMHANEILDGKDLPLLYVGVSPCFRKEAGTAGRVHQFHKVEQFVYESWEWHEKIIRNAEELFQELEIPYRVVNICTGDLGYVAAKKYD--EVVSNIRFRDRTDEKPRYVHTLNSTAIATSRAIVA---LENHQEEDGTVRIPKVLW... 435
75 -11.1003qne_A mol:protein length:485 Seryl-tRNA synthetase, cytoplasmic  ali model follow..  17  191...........................................................LINYGLSFLSSKGYVPLQAPVMMNKEVMAKTAQQFDEELYKVIDGEDEKYLIATSEQPISAYHAGEWFESPAEPVRYAGYSSCFRREAGSHGRVHAFEKIEQFVLKSWEEFDRMIGCSEEFYQSLGLPYRVVGIVSGELNNAAAKKY-DLEA......................................................... 356

FFAS is supported by the NIH grant R01-GM087218-01
1 2 4 5 2 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Grynberg M, Godzik A. NERD: a DNA processing-related domain present in the anthrax virulence plasmid, pXO1. Trends Biochem Sci. 2004 Mar;29(3):106-10.