current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 4tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .
# Score Template Links and tools%idFirst MGSSSSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLSFIQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNLLast
1 -134.0004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model  100  1MGSSSSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLSFIQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 285
2 -128.0002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  98  1MGSSSSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSGSYYNGISTNL 285
3 -122.0004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  98  1MGSSSSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLGNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPRPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 285
4 -120.0004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  97  1..................PALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMVAPNIFNYARKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFFQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCSVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 267
5 -119.0003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  97  2....KGGLVPRGSHGASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLTPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLVFWQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSALVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 282
6 -114.0004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  98  2..................PALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLANYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 268
7 -77.7002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  39  11...RGSHMFLTRRDPPLSSFWTKVQYQRLKELNASGEQLALSRDRAFQGIEHQLMSQGKRHLEQLRTVKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEDHPLFSQVFWLDGKKCLRPMLAPNLYTLWRELERLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEHQRLEDMARWVLEAAGIEFELVTESSVVYGDTVDVMKGDLELASGAMGPHFLDEKWEIFDPWVGLGFGLERLLMIREGTQHVQSMARSLSYLDGVRLNI 301
8 -53.0003l4g_A mol:protein length:508 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  15  158.ELRKRKLLAEVTLKTYWVSKGSAFSTSIS------KQETELSPEMISSGSWRDRPFKPYNFLAHPDSGHLHPLLKVRSQFRQIFLEMGFTEMPTALFQPQQHPARDQHDTFF--YNWKLDEARKNLLRTHTTSASARALYRLAQKKPTPVKYFSIDRVFRNETLDATHLAEFHQIEGVVADHGLTLGHLMGVLREFFTKLGITQLRFKPAYNPYTEPSMEVFKWVEVGNSGVFRPEMLLPMGLPESVIAWGLSLERPTMIKYGINNIRELVGHKVNLQMVYDS. 490
9 -49.3001b70_A mol:protein length:350 PHENYLALANYL-TRNA SYNTHETASE  ali model follow..  15  22..........KARYLGKKGLLTQEMKGLSALPLEERRKRGQELNAIKAALEAAKEALERERVDVSLPGGGLHPITLMERELVEIFRALGYQAVEGPEVEPEHHPARDMWDTFWLTGEGF-EVEGRLLLRTHTSPMQVRYMVAH----TPPFRIVVPGRVFRFEQTDATHEAVFHQLEGLVVGEGIAMAHLKGAIYELAQALFGPKVRFQPVYFPFVEPGAQFAKWLELGGAGMVHPKVFQAVDAYRTGFAFGLGVERLAMLRYGIPDIRYFFGGRLKF....... 342
10 -48.1002rhq_A mol:protein length:294 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  15  7.................................GLVPRGSHMGTELMEKLNQQ---LAEETIDVTLPSGSKHPLTRTVEEIEDLFLGLGYEIVDGYEVEPKSHPARDMQDS--------FYITDEILMRTHTSPVQARTMEK--RNGQGPVKIICPGKVYRRDSDDATHSHQFTQIEGLVVDKNIKMSDLKGTLELVAKKLFGAEIRLRPSYFPFTEPSVEVDGWIEILGAGMVHPNVLEMAGFDSSGFAFGMGPDRIAMLKYGIEDIRYFYTNDVRF....... 276
11 -47.2003pco_A mol:protein length:327 Phenylalanyl-tRNA synthetase, alpha subunit  ali model follow..  16  28..........RVEYLGKKGHLTLQMTTLRELPPEERPAAGAVINEAKEQVQQANARLAAETIDVSLPGGGLHPVTRTIDRIESFFGELGFTVATGPEIEPGHHPARADHDT--------FWFDTTRLLRTQTSGVQIRTMKAQ----QPPIRIIAPGRVYRNDY-DQTHTPMFHQMEGLIVDTNISFTNLKGTLHDFLRNFFEEQIRFRPSYFPFTEPSAEVDKWLEVLGCGMVHPNVLRNVGIDPSGFAFGMGMERLTMLRYGVTDLRSFFENDLRF....... 322
12 -46.7002du3_A mol:protein length:534 O-phosphoseryl-tRNA synthetase  ali model follow..  15  1...............................MKFDPQKYRELAEKDFEAAWKAGKEIAERSPNELYPRGKEHPLFATIQRLREAYLSIGFSEVVNPLIVEDVHVKKQFGREALAVLDRCFYISSTLTLRSHMTTGWFITLSHIADKLPLPIKLFSIDRCFRREQEDATRLYTYFSASCVLVDEELSVDDGKAVAEALLRQFGFENFRFREKRSKYYIPDTQTEGWIEIATFGIYSPTALAEYDIPYPVMNLGLGVERLAMILYGYDDVRKMVYPQIHGEIKLSDL 360
13 -45.8004p71_C mol:protein length:338 Phenylalanine--tRNA ligase alpha subunit  ali model follow..  15  28..........RVHYLGKKGELTQVMKTLGDLPAEERPKVGALINVAKEKVQDVAARLAAERIDVTLPGGGLHPVTRTLERIEQCFSRIGYEVAEGPEVEPGHHPARAMHDT--------FYFNANMLLRTHTSPVQVRTMESQ----QPPIRIVCPGRVYRCDS-DLTHSPMFHQVEGLLVDEGVSFADLKGTIEEFLRAFFEKEVRFRPSFFPFTEPSAEVDGWLEVMGCGMVHPNVLRMSNIDFQGFAFGMGAERLAMLRYGVNDLRLFFDNDLRF....... 333
14 -44.5002du7_A mol:protein length:549 O-phosphoseryl-tRNA synthetase  ali model follow..  16  2......................KLKHKRDDKMRFDIKKVLELAEKDFETARETRALIKDKHIDNKYPRGKPHPVMETIERLRQAYLRMGFEEMINPVIVDEMEIYKQFGPEAMAVLDRCFYLATTLTLRSHMTSGWFITLSSLIKKRKLPLKLFSIDRCFRREQRDRSHLMSYHSASCVVVGEDVSVDDGKVVAEGLLAQFGFTKFKFKPKKSKYYTPETQTEEWIEVATFGVYSPIALAKYNIDVPVMNLGLGVERLAMIIYGYEDVRAMVYPQFYEYRLS... 361
15 -34.0003cmq_A mol:protein length:415 Phenylalanyl-tRNA synthetase, mitochondrial  ali model follow..  17  42.................................................................LHNQQHHPLWLIKERVKEHFYKQYVGRFGTPLFIPADHPSRKKGDN--------YYLNRTHMLRAHTSAHQWDLLHA------GLDAFLVVGDVYRRDQIDSQHYPIFHQLEAVRLAVKLVEFDLKQTLTRLMAHLFGDELEIRDCYFPFTHPSFEMEEWLEVLGCGVMEQQLVNSAGAQRIGWAFGLGLERLAMILYDIPDIRLFWCEDERF....... 303
16 -30.7003g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  18  20.........................................................................RAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPFETRFVGPGHSQGINLYLMTSPEYHMKRLL------AAGCGPVFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDMYMNEVDDLLQQVLDCQPAESLSYQQAFQRHLEIDPLSADKTQLREAALFTMGVEPHIGKEKPTFIYHFPASQASLAQISTEDHRVAERFEVYYKGIEL.. 246
17 -30.3003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  18  28....................................................................PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGPGHSQGMNLWLMTSPEYHMKRLL------VAGCGPVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPLSADKTQLREVALFTFGVEPNIGKEKPTFVYHFPASQASLAQISTEDHRVAERFEVYYKGIEL.. 259
18 -27.7003a74_A mol:protein length:493 Lysyl-tRNA synthetase  ali model follow..  16  104......KISDLGDIVGVRGTMFKTKVGELSIKVSSYEFLTKALPEKYHGLKDIEQRYRQRYLDLIMNPESKKTRSLIIQSMRRYLDSHGYLEVETPMMVAGGAAARPFITHHNAL-------DMTLYMRIAIELHLKRLI------VGGLEKVYEIGRVFRNEGISTRHNPEFTMLELYE--AYADFRDIMKLTENLIAHIA--TEVLGTTKIQYEHLVDLTPEWRRLHMVDAIKEELAKEHGVEQPTFIYGHPVEISPLAKKNPDDPRFTDRFELFIVGREH.. 412
19 -27.4001bbu_A mol:protein length:504 PROTEIN (LYSYL-TRNA SYNTHETASE)  ali model follow..  20  113......KKWDLGDILGAKGKLFKTKTGELSIHCTELRLLTKALPDKFHGLQDQEARYRQRYLDLISNDESRNTRSQILSGIRQFMVNRGFMEVETPMMIPGGAAARPFITHHNAL-------DLDMYLRIAPELYLKRLV------VGGFERVFEINRNFRNEGISVRHNPEFTMMELYM--AYADYKDLIELTESLFRTLA--QDILGKTEVTYDVTLDFGKPFEKLTMREAIKKAIAESIGIHQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREI.. 422
20 -27.4001e1o_A mol:protein length:504 LYSYL-TRNA SYNTHETASE, HEAT INDUCIBLE  ali model follow..  19  113......KKWDLGDIIGARGTLFKTQTGELSIHCTELRLLTKALPDKFHGLQDQEVRYRQRYLDLIANDKSRQTRSKILAAIRQFMVARGFMEVETPMMIPGGASARPFITHHNAL-------DLDMYLRIAPELYLKRLV------VGGFERVFEINRNFRNEGISVRHNPEFTMMELYM--AYADYHDLIELTESLFRTLA--QEVLGTTKVTYEHVFDFGKPFEKLTMREAIKKALAESIGITQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREI.. 422
21 -26.7004ex5_A mol:protein length:529 Lysine--tRNA ligase  ali model follow..  18  128......KKWDLGDIVAARGVLFRTNKGELSVKCTQLRLLAKALPDKFHGLADQETRYRQRYVDLIVTPETRTTRTKAIASIRKFMGDADFMEVETPMLIPGGAAAKPFVTHHNAL-------DMEMFLRIAPELYLKRLI------VGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYA--AYTDYRWLMDFTERLIRQAA--VDALGTATIQYGRELDLAQPFHRLTITQAIQKSELKRLGVDEPTFIIDYPIEVSPLARESDTVAGITERFELFITGREI.. 441
22 -26.3001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  16  2...................................................YRLQIEKIRGFRDFYPEDMDV-EKFIFKTAEEAAEAFGFRRIDFPSLEYLDYRIKSGEELLQQTYSFVDKGGREVTLIPEATPSTVRMVTSR-KDLQRPLRWYSFPKVWRYEEPQAGRYREHYQFNADIFGSDSPEADAEALASSILDRLGLQ................................................................................. 155
23 -26.2001z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subu  ali model follow..  13  4...........................................SGSIEGRMEKINYLLPEESAEMTLNQVKS-LRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGKTFNQEKMFQFGQSITLRYDFTLPLVRLYSQIKD--STSARYSYFGKIFRKEKRHKGRSTENYQIGIELFGESADKSELESLALQVIEQLGLNKTVFEIGSAKFFQRL.................................................................. 182
24 -26.0003bju_A mol:protein length:521 Lysyl-tRNA synthetase  ali model follow..  18  103...HINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLPHLHFGLKDKETRYRQRYLDLILNDFVRQKFSKIITYIRSFLDELGFLEIETPMMIPGGAVAKPFITYHNELDMNLYRIAPELYHKMLVVGGI---------------RVYEIGRQFRNEGIDLTHNPEFTTCEFYM--AYADYHDLMEITEKMVSGMVLEVTCINPTFICLTERFELFVMKKEICNA-FEEQAKAKAAGDDEPTAGWGMGIDRVAMFLTDSNNIKEV.............. 499
25 -25.8004up7_A mol:protein length:777 LYSINE--TRNA LIGASE  ali model follow..  20  104......KMIYRGDICGFTGHPTRTKTGELSLIPISGMILSPCLPSMHYGLGDQETRFRKRYLDLIVNPESVKNFTKVVKAVRKYLDDKGFLEVETPILIPGGATARPFITHHNQLDIQMYRIAPELYLKELVVGGI---------------RVYEIGRLFRNEGIDQTHNPEFTTCEFYM--AYADYNDIMKMTEELLGNMVKDITGGSTKLEIKDRLMDI................................................................ 311
26 -24.9003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  20  2...................AMGTLEAQTQGPGSMQKNMVETEPVQGCRDFPPEAMRCRRH----------------LFDVFHATAKTFGFEEYDAPVLESEEYIRKAGEEITEQMFNFITKGGHRVALRPEMTPSLARLLLGKGRSLLLPAKWYSIPQCWRYEAITRGRRREHYQWNMDIVGVKSVSAEVECAACWAMRSLGLSSKDVG----------------IKVNSRKV----------LQTVVEQAGVTSDKFAPVCVIVDKMEKIPREEVEAQLAVLGL 228
27 -24.6003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  20  2...................AMGTLEAQTQGPGSMQMNMVETEPVQGCRDFPPETMRLRKY----------------LFDVFHSTARKFGFEEYDSPVLESEEYIRKAGEEITEQMFNFITKGGHRVALRPEMTPSLARQLLAKGRSLLLPAKWYSIPQCWRYEAITRGRRREHYQWNMDIIGVKSVSSEVECAACTAMQSLGLSSKDVG----------------VKINSRKI----------LQTVVEQAGVSADKFAPVCVIVDKMEKLPREEVVAQLAAIGL 228
28 -24.5004rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  20  2....................................................PMTARAVRGTKDLFGKELRMH-QRIVATARKVLEAAGALELVTPIFEETQVFEKGVGAATDIVRKEMFRGGRSLTLRPETAAMVRAYLEHGMKVWPQPVRLWMAGPMFRAERPQKGRYRQFHQVNYEALGSENPILDAEVLLYECLKELGLRRLKVKLSSV-YVRTAEEIGAQSALGGGGRYDGLSELLGGPRVPGVGFAFGVERVALA........................ 317
29 -24.2003ig2_A mol:protein length:213 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  17  7..........................................................................NKLQNLVAEQLVGCGFNEILNNSLTRAAYYDGLESYPSKNLVMLLNPLSADLCMRQTLLFGGLESIAHNANRKNADLKFFEFGNCYHFDAEKKNPEKEDYHLGLWVTGENTSVYELKAYVENIFKRLGLDLHSLVVGNLS-TALTVNTKGGKRLATFGVVTKKMLKAFDVDNEVYYADLNWKELM.......................... 213
30 -24.2001qe0_A mol:protein length:420 HISTIDYL-TRNA SYNTHETASE  ali model follow..  18  1......................................................MIKIPRGTQDILPEDSKKW-RYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSTDVVQKEMYKGDRSITLRPEGTAAVVRSYHKMQGNPNQPIKLYYNGPMFRYERKQKGRYRQFNQFGVEAIGAENPSVDAEAMVMHIYQSFGLKHLKLVINSV-YTHTAFELMAITTLCGGGRYNGLLELLDGPSETGIGFALSIERLLLA........................ 316
31 -24.1004ycv_A mol:protein length:516 Lysine--tRNA ligase  ali model follow..  17  104...ECYDKIRRGDIVGIVGFPGKSKKGELSIFPKETILLSACLHML--GLKDTEIRYRQRYLDLLINESSRHTFTKIINFLRNFLNERGFFEVETPMMIAGGANARPFITHHNDLDLDLYRIATELPLKMLIVGGI---------------KVYEIGKVFRNEGIDNTHNPEFTSCEFYW--AYADYNDLIKWSEDFFSQLV--YHLFGTYKISYNKEIDFTPPYPKVSIVEEIEKHFIENKYNDKPFFIVEHPQIMSPLAKYHRTKPGLTERLEMFICGKEV.. 426
32 -23.5004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  15  30...........................................................KGMNDILPQDAGLW-EFFEATVKSLLRAYGYQNIRTPIVEHTPLFTRGIGEVTDIVEKEMYSFGENLTLRPENTAAVVRAAIEHNMLYDGPKRLWYIGPMFRHERPQRGRYRQFHQVGVEALGFAGPDADAEMMCQRLWEDLGLTGIKLEINSLVFEWVTDKLGAQGTVAAGGRYDPLIEQLGGKPTAACGWAMGIERILELLKEEHLVPEQEGVDVYV....... 353
33 -23.5003ica_A mol:protein length:213 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  18  8...........................................................................KWQTVVSEQLVGAGFNEILNNSLTAGSYYEGLKSHPREMAVELMNPLSQELCMRQTLLFGGLETLSHNLRRKHLSLYLFEWGKCYRFHAAKRTDYAEDDRLGIWICGEPTSVFELKAVVEQVLCRVGIETGAYADNDLYASAMEVKTRSGKLLGTFGTVSTELIKRFEIEQPVYFAELLWDALM.......................... 213
34 -21.5002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  16  16...........................................................RGMNDYLPGETAIW-QRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFGDSLTLRPEGTAGCVRAGIEHGLLYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDIDAEMLTARWWRALGISEHV---NRTVFEWVTNSLGSQGTVCAGGRYDGLVEQLGGRATPAVGFAMGLERLVLLVQAVN................... 327
35 -21.2005e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  15  10...........................................................KGFNDVLPTQTAAW-RRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRAIGDATDIVEKEMYTFPESLTLRPEGTAGCVRALVEHNLLRGATPRVWYMGPMFRYEKPQKGRYRQFHQFGVETFGVATPDAELIMLTARLWKRMGVDHMV---NKTVFEWTTTALGSQGTVCAGGRYDGLVGQLKG-SVPAVGFAMGMERLLLLLEQVEQAEIVRDCEAFL....... 338
36 -21.1003l4g_B mol:protein length:589 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  13  320IRETPENLAKLLTRMYLKSEVIGDGNQIEIEIPPTRADIIHACD-----VEDAAIAYGYNNIQMTLPKANQFPLNKLTELLRHDMAAAGFTEALTFALCSQEDIADKLISATKAVHISNPKTAEFQVARTTLLPGLLKTIAANRKM-PLPLKLFEISDIVIKDSNTDVGAKNYRHLCAVYYNKNPGFEIIHGLLDRIMQLLDVPPGEDKGGYVI-GRCAEIFARGQSVGKLGVLHPDVITKFELTMPCSSLEINIGPFL.......................... 589
37 -21.1003mey_A mol:protein length:346 Bll0957 protein  ali model follow..  13  1............................MGSSSSGLVPRGSHMNIAVLPNSPDTAPQIADPLDHLADKLRTALYESIVERLAALITEAGTEALRFPPVMSRAQLEKSGSRFDAGGDWTTSLSPADLVLSPAACYPVYPIAASRGPLPKGGLRFDVAADCFRRESKHLDRLQSFRMREYVCIGTPDDVERWMVRAQAIARDLGLTFRVDYASDPFFGRVGQMKEQPTACMSFNYHREHFGTTWGIQDA--CVAFGMDRLAVATHGTD................... 312
38 -20.7004h2w_A mol:protein length:346 Amino acid--[acyl-carrier-protein] ligase 1  ali model follow..  13  1............................MGSSSSGLVPRGSHMNIAVLPNSPDTAPQIADPLDHLADKLFHSLYESIVERLAALITEAGTEALRFPPVMSRAQLEKSGSRFDAGGDWTTSLSPADLVLSPAACYPVYPIAASRGPLPKGGLRFDVAADCFRRESKHLDRLQSFRMREYVCIGTPDDVERWMVRAQAIARDLGLTFRVDYASDPFFGRPLRSEEQPTACMSFNYHREHFGTTWGIQDA--CVAFGMDRLAVATHGTD................... 312
39 -20.6003od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subu  ali model follow..  12  2...............................................NAMSKPFMFEKPFGMRDTLPEWYKT-KKNICDQMTEEINLWGYDMIETPTLEYYETVGVVSAILDQQLFKLLDQQGNTLVLRPDMTAPIARLVASSLKDRAYPLRLAYQSNVYRAQQNEGGKPAEFEQLGVELIGDGTASADGEALMIAALKRAGLSEFK------------------VAIGHVGYVN-ALLMDVVGNEQRAD--VGYREHVKSLNLSTIDKSRLMNLLSLRG..... 225
40 -20.2003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  15  18..................................................AVRGFADRPPGMQDGYPDFAKR-RRAVETRLLSFVEDAGYEPVTSGLFEYVDTLLRASPESSRDWIRLFDGGGDAVALRPEMTPSIARMAAPRVAAGRTPIRWCYCERVYRRTDDPSGKAAESTQVGIERIGEEASVDDVLRLLHEASAAAGVRHHR------------------IVVSHARLVP-RLLDALGISAS...................................... 204
41 -20.0001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  18  89......................EILPEKIVVLNRAETPLPLDPTGKVKAELDTRLNNRFMDLRRPEVMAIFKIRSSVFKAVRDFFHENGFIEIHTPKIIATATEGGTELFPMKYFEEDAFLAESPQLYKEIMMASGLD-------------RVYEIAPIFRAEEHNTRHLNEAWSID-SEMAFIEDEEEVMSFLERLVAHA---YIMKYDNKPEICRAFDLEYRGVEISSGGQ--VEQIKEKGLNPESFGFGLGAERLIKQMLDLPNIREV.............. 426
42 -19.7001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  15  86......................ELHAEEITLLSKAKAPLPLDVSGKVKADIDTRLRERVLDLRRQEMQAVIKIQSLALKAFRETLYKEGFIEIFTPKIIASATEGGAQLFPVIYFGKEAFLAQSPQLYKELMAGVV---------------RVFEVAPAWRAEESDTFHLAEFISMDVEM--AFADYNDVMQLLEKILHNI---YTKSKSENPELSESFDLIYKFLEIVSGST--EEALKKKGLKPESFGFGMGLARLMVMLTGIQSVKEI.............. 417
43 -18.6001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  23  16.......................................................................DIQTKILEYMTDFFVKEGFKWLLPVIISPITDPLWPDPAGEGMEPAEVEIYGVKMRL------THSMILHKQLAIAMGLKKIFVLSPNIRLESRQKRHAYEFTQLDFEV--ERAKMEDIMRLIERLVYGLFRKAEEWTGREFPYSEVLEEFYGYGEVASGGEREWEYIAKAGKLKPSAGAGIGVERLVRFIVGAKHIAEV.............. 281
44 -18.3003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  14  1.............................SNAMAKNDKINFSTPSGFPEFLPSEKRLELY----------------LLDTIRRVYESYGFTPIETPAVERLEVLQAKGNQGDNIIYGLEPILPEARALKFDQTVPLAAYIARHLNDLTFPFARYQMDVVFRGERAKDGRFRQFRQCDIDVVGRELYDAQMPAIITEIFEAVNIGDFVIRINN--FFQSLNISETQIKSCISIIDNLEKIGEAKVKLELEKEGINPEQTQKI........................ 239
45 -18.2003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related  ali model follow..  23  16.......................................................................DIQTKILDYMTKFFTDRGFKWLLPIMLSPITDPLWPDPAGEGIRPAEVDVYGVRMRL------THSMILHKQLAIAMGLEKIFVLSPNIRLESRRKRHSYEFTQLDFEI--EGAKMKDVMRLIEELIYGLFRKAEEWTGREFPRARHFKVYYGYGEVSSGGEREWEYIARAGKLKPSAGAGIGVERLVRFIVGAKHIAEV.............. 281
46 -18.0001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  18  76......................EVQAKEVEVLSPALEPTPVEIPKEEWRANDTLLEYRYVTLRGEKARAPLKVQAALVRGFRRYLDRQDFTEIFTPKVVRAGAEGGSGLFGVDYFEKRAYLAQSPQLYKQIMVGVF---------------RVYEVAPVWRMEEHHTRHLNEYLSLD-VEMGFIADEEDLMRLEEALLAEMSVRPFYTYPEEDGTTRSFDLLFRGLEITSGGQ--LESLKAKGMDPEAFGFAIGAERLTQKLLGLPNVRYA.............. 410
47 -18.0003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  19  196......................DLTKRPLKDEYAKLLKEKASAQKYVKVSQDTRLDNRMLDLRTVTNIAIFRIQSACCGLFREFLTSQKFVEIHTPKLIGCS-------SEGGSNIFEVKYFDRKAYLAQ--SPQLYKQM----AIMGDFRKVFEVGPVFRAENSNTRHLTEFEGLD-IEMEIVENYHECIDVMEKLFTFI---YTMPDIDDPNYSNSYDVFVRGQEITSGAQ--MKRCIEKGVDPATLGCGIGLERITMLYLGIPNIRKV.............. 536
48 -17.4004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  17  150............ELHVQKIYVISLAEPRLPLQLDDAVRPEAEGEEEGRATVNQDTRLDNRVIDLRTSTSQARLQSGICHLFRETLINKGFVEIQTPKIISAA-------SEGGANVFTVSYFKNNAYLAQ--SPQLYKQM----CICADFEKVFSIGPVFRAEDSNTRHLTEFVGLD-IEMAFNYHYHEVMEEIADTMVQI---YTMPDPRNPKQSNSYDMFMRGEEILSGAQ--TERALHHGIDLEKIGGGIGLERVTMLFLGLHNVRQT.............. 503
49 -16.9003w3s_A mol:protein length:527 Type-2 serine--tRNA ligase  ali model follow..  16  147..LRRHVIDRVIRLVAWAVEERSELVERVTKVEPGTVVDESGPRRIRFRGDVTEEARRRGWVKEFPGRGQTPPMAALFEVLRDFLLERGFEPALFPKLIPLETMFRMRYELFDDFKRELYVWGEGYVLAPAQCEPFYELLRDEVVDPERPIKLYDCGWTYRWEGKGLERVNEFQRIEHVWIAEPEEARELLEATKRVAEELELEWKVVVSDYLPFKGERSSEEAWISVGSFNVHGEHFVDGFNVKEK--CAGLGVTRWVVG........................ 489
50 -16.7001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  15  124........ITKIYTISETPEALPILLEDASRSEAEAEAAGLPVVNLDTRLDYRVIDLRTVTNQAIF-----RIQAGVCELFREYLATKKFTEVHTPKLLGAPSEGGSSVFEVTYFKGKAYLAQSPQFNKQQLIVADFE-------------RVYEIGPVFRAENSNTRHMTEFTGLD-MEMAFEEHYHEVLDTLSELFVFI---YTMPDPANPKYSNSYDFFMRGEEILSGAQ--QERMKAHGLSPPHAGGGIGLERVVMFYLDLKNIRRA.............. 478
51 -16.5004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  14  4SEFELRRQMAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLT---NIKRYHIAKVYRRDNMTRGRYREFYQCDFDIAGNFDPMAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICG-LDKVSWEEVKNEMVGEKGLAPEVAD----IGDYVQQHGGVSLVEQLLQDPK......... 299
52 -16.2001usy_A mol:protein length:275 ATP PHOSPHORIBOSYLTRANSFERASE REGULATORY SUBU  ali model follow..  16  7...........................................................................EKVFSFYSKATKKGFSPFFVPALEKAEEPA---------GNFFLDRKGNLFSIREDFTKTVLNHRKRYSP--DSQIKVWYADFVYRYSG---SDLVAEYQLGLEKVPRNSLDDSLEEIIVESASEFFEGPVIVEIGHTGVYEDL.................................................................. 138
53 -16.2002cim_A mol:protein length:522 SERYL-TRNA SYNTHETASE  ali model follow..  14  168.............................EKIEAAQYGAKAEHWNLLWQREPMEHPFKEDPTQAMMKEG-GPQSARIFRTFEKIVLEEGYREMIFPKLVTWEVWMKSGTHEVPTKLIKEKIAEPIGGMCYAQCPPFWMYVAGETLPNEEPVKVFDRGTSHRYESHGIERVDEFHRIEIVWIGTKEEVLKLHDRYMHIFNDILDIEWRKARVTPWFMAQEGLLGEWLEFQNVSINGDKYPKGFNVKLQ---SGVGLERWAAVQKGLD................... 494
54 -15.9001eqr_A mol:protein length:590 ASPARTYL-TRNA SYNTHETASE  ali model follow..  20  86......................DMATGEIEVLASSLTIINRADVLPLDS-EEARLKYRYLDLRRPEMAQRLKTRAKITSLVRRFMDDHGFLDIETPMLTKAT--ARDYLVPSRVHKGKFYALPQ--------SPQLFKQL----LMMSGFDRYYQIVKCFRDEDLRADRQPEFTQIDVET--SFMTAPQVREVMEALVRHLWLEVKGVDLGDFP------------------MTFAEAERRYGSDKPDLRNPMELTDVADLLKSVE................... 303
55 -15.7004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  15  7.................................ELRRQFVLKTPKGTRDYSPRQMAVREK----------------VFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLT---NIKRYHIAKVYRRDNMTRGRYREFYQCDFDIAGNFDPMAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICG-LDKVSWEEVKNEMVGEKGLAPEVAD----IGDYVQQHGGVSLVEQLLQDPK......... 246
56 -15.5004rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  19  85......................EIPTGQIEVNATELTVLGESAPLPFQ--EEARLKYRYLDLRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTLTRST--ARDFLVPARLQPGSFYALPQ--------SPQLFKQL----LMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMVEADDVIAISEQVLKAVWATIGYD---------------------LPLPLPRISYEEAMRRFGSDKPDLRFGIELVECTEYFKDTT................... 302
57 -15.5001efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model follow..  16  73.GLVRLRPEPNPRLATGRVEVELSALEVLAEAKTPPFPVDAGWRGEEEKEASEELRLKYRYLDLRRRRMQENLRHRVIKAIWDFLDREGFVQVETPFLTKST--ARDFLVPYRHEPGLFYALPQ--------SPQLFKQM----LMVAGLDRYFQIARCFRDEDLRADRQPDFTQLDLEM--SFVEVEDVLELNERLMAHVFREALGVE----------------LPLPFPRLSYEEAMERYGSDKPDLRFGLELKEVGPLFRQSG................... 310
58 -15.4004wj3_M mol:protein length:599 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  18  89......................NMASGSIEVLGYELEVLNQAETPPFP--EETRLRYRFIDLRRPEMAAKLKLRARITSSIRRYLDDNGFLDVETPILGRPT--ARDYLVPSRTYPGHFFALPQ--------SPQLFKQL----LMVAGFDRYYQIAKCFRDEDLRADRQPEFTQIDIET--SFLDESDIIGITEKMVRQLFKEVLDVEFDEFP------------------MPFEEAMRRYGSDKPDLRIPLELVDVADQLKEVE................... 308
59 -15.4004o2d_A mol:protein length:620 Aspartate--tRNA ligase  ali model follow..  18  101......................EIPTGQIEVNATELTVLGESAPLPFDEQAGEEARLKYRYLDLRREGPGNALRSKVNAAARSVLAEHDFVEIETPTLTRST--ARDFLVPARLQPGSFYALPQ--------SPQLFKQL----LMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMVEADDVIAISEQVLKAVWATIGYD---------------------LPLPLPRISYEEAMRRFGSDKPDLRFGIELVECTEYFKDTT................... 318
60 -14.5004ah6_A mol:protein length:617 ASPARTATE--TRNA LIGASE, MITOCHONDRIAL  ali model follow..  17  94......................KMPTGEIEIKVKTAELLNACKKLPFKKTEALRLQYRYLDLRSFQMQYNLRLRSQMVMKMREYLCNHGFVDIETPTLF------KRTPGGAKEFLVPSREPGKFYSLPQ--SPQQFKQL----LMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEM--SFVDQTGIQSLIEGLLQYS-----------------WPNDKDPVVVPFPTMTFAEVLATYGTDKPDTRFGMKIIDISDVFRNTE................... 313
61 -14.2001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  14  71.SVIVEGIVKADERAPGGAEVHVEKLEVIQAVSEFPIPENPEQASPELLLDYRHLHIRTPKASAIM-----KVKETLIMAAREWLLKDGWHEVFPPILVTGAVEGGATLFKLKYFDKYAYLSQSAQLYLEAAIFGL---------------KVWSLTPSFRAEKSRTRHLTEFWHLELEA--AWMDLWDIMKVEEELVSYM-LKNTEPPFPRISYDEAIDILQS--EIIGGSQREDDYDLEEGMDPKDYGFGLGVERLVAWVLKLDHIRWA.............. 422
62 -13.1003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  13  91LNAYAGKNHPPEIADILNLEMQVTEWKVIGESPIDLENIINKDSSIPQKMQNRHIVIRSEHTQQVL-----QLRSEIQWYFRKYYHDNHFTEIQPPTIVKTQCEGGSTLFKLQYFNEPAYLTQSSQLYLESVIASL---------------KSFCMLSSYRAESRTVRHLAEYLHLEAEL--PFISFEDLLNHLEDLVCTVHLKLPTRPFKRMTYADAIKYCND--EIVGGSMRIWNYDKANGLNPDPYGYGLGVERLVMWLLGEDHIRKV.............. 444
63 -12.8002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUT  ali model follow..  18  118.................................................LDNRHLVIRGENAAALL-----RLRAAATRAMREHFYNAGYVEVAPPTLVQTQVEGGSTLFNLDYFGEQSFLTQSSQLYLETCIPTL---------------DVFCIAQSYRAESRTRRHLAEYAHVEAEC--PFITLDDLMEKIEELVCDTKFQPPERPFLRMEYKDAIKWLQE--EIVGGSMRIWKFDKNVEIDPKPYGYGLGLERFICWLTNTNHIRDV.............. 425
64 -12.3004hwo_A mol:protein length:411 Threonine--tRNA ligase  ali model follow..  18  36..........................................................................RELEVFVRSKLKEYQYQEVKGPFMMDRVLWEKTGHDNYKDAMFTTSSENREYCIKPMNCPGHVQIFNQGLKSYRDPLRMAEFGSCHRNEPSGSLHVRGFTQDDAHIIGSDEMWDRAEADLAVALEENNIPFEYQLGEGAFYGPKIEFTLYDCRAWQCGTVQLDFSLPSRLSASYVGEDNERKVPVMIH------RAILGSMERFIGILTE. 288
65 -11.9002i4l_A mol:protein length:458 Proline-tRNA ligase  ali model follow..  18  1MGSSSSGLVPRGSHMRLSRFFLPILKENPKEAEIVSHRL----------LRAGMLRQEAAGIYAWLPLGHR-VLKKIEQIVREEQNRAGAIELLMPTLQLADLWRESGDAYGPEMLRIADRHKRELLYGPTNEEMITEIFRAYIKSYKSPLNLYHIQWKFRDERFGVMRGREFLMKDAYSFDVDEAYNKMFVAYLRTFARMGLKAIPMRAETGPIGGDLS................................................................. 221
66 -11.4003a31_A mol:protein length:471 Probable threonyl-tRNA synthetase 1  ali model follow..  14  1....................MASGQDKTHIDYAYELDITVKPDSRVP-VFNREFATFTGAGVPLFSLGGGP-IRYALAEVLAKFHARRGYYVVETPIIASTELFKVSGHEFYRNNMYLFDIEGHEFAVKPMNCPYHILLFLNEVAKHRSPFKVFEFGRVHRYEPSGSIYVRGFTQDDAHIIDVVYDVFEEMKLVLERLFKLGVSSETFK............................................................................ 203
67 -11.2001nyq_A mol:protein length:645 threonyl-tRNA synthetase 1  ali model follow..  15  186..VPSTAKIKEFKLLSTAGAY-DSNNKMLQRIYGTAFFDKKELKAHLQMLEERKERDHRKELELFTNSQLVGARREIERYIVDKEVSMGYDHVYTPVLANVDLYKTSGH-QEDMFPPMQLDETESMVLRPMNCPHHMMIYANKPHSYREPIRIAELGTMHRYEASGAVSVRGMTLNDSHIFVRPDQIKEVVNMIIDVYKDFGFEDYSFRLSYRDPEDKEKYFDDDDMWNKAENMLKEAADELGLSYEAAFYGPKLD----------QVKTAMGKEETLSTAQLDF 493
68 -10.9004p3n_A mol:protein length:415 Threonine--tRNA ligase, cytoplasmic  ali model follow..  20  40..........................................................................NALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFSFEVEKEFALKPMNCPGHCLMFDHRPRSWREPLRLADFGVLHRNELSGATRVRRFQQDDAHIFCAMEQIEDCLDFLRTVYSVFGFSFKL.............................................................................. 182
69 -10.9001qf6_A mol:protein length:642 THREONYL-TRNA SYNTHETASE  ali model follow..  14  210.........SNNKMLQRIYGTAWADKKALNAYLQRLEEAAKRDHRKIGKQLDLYHMQEEAPGMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRVLWEKTGHDNYKDAMFTTSSENREYCIKPMNCPGHVQIFNQGLKSYRDPLRMAEFGSCHRNEPSGSLHVRGFTQDDAHIIGSDEMWDRAEADLAVALEENNIPFEYQLGEGAFYGPKIEFTLYDCRAWQCGTVQLDFSLPSRLSASYVGEDNERKVPVMIH------RAILGSMERFIGILTE. 527
70 -10.9003lsq_A mol:protein length:484 Seryl-tRNA synthetase  ali model follow..  19  214............................................................................LVSYSLDFLVKRGYTPFYPPFFLNRDVMGEVAQQFDEELYQVSGDGDKKYLIATSEMPIAAYHRGRWFTELKEPLKYAGMSTCFRKEAGAHGRVHQFDKIEQFVVESWRHLEDMITTSEEFNKSLGLPYRVVN............................................................................ 361
71 -10.8004hwt_A mol:protein length:413 Threonine--tRNA ligase, cytoplasmic  ali model follow..  20  36..........................................................................NALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFSFEVEKEFALKPMNCPGHCLMFDHRPRSWREPLRLADFGVLHRNELSGATRVRRFQQDDAHIFCAMEQIEDCLDFLRTVYSVFGFSFKL.............................................................................. 178
72 -10.8001wle_A mol:protein length:501 Seryl-tRNA synthetase  ali model follow..  18  219............................................................................LVNFTLNKLIHRGFTPMTVPDLLRGVVFEGCGMKPSQIYNIDPSRFEDLNLAGTAEVGLAGYFMDHSVAFRDLPIRMVCSSTCYRAETDTGKRVHHFTKVEMFGVQSSELLEEFLSLQMEILTELGLHFRVLDMPTQELGLPAYRKFDFGEVTSASNCTDFQSRRLHIMHTVNATGCAVPRLLIA---LESYQQKDGS........... 451
73 -10.1001ser_A mol:protein length:421 PROTEIN (SERYL-TRNA SYNTHETASE (E.C.6.1.1.11)  ali model follow..  14  172............................................................................LLRFAMDFMARRGFLPMTLPSYAREKAFLGTGHFPAYRDQVWAIAETDLYLTGTAEVVLNALHSGEILPYEALPLRYAGYAPAFRSEAGSFGRVHQFHKVEQYVLASDRAFQELLENAEEILRLLELPYRLV............................................................................. 316
74 -10.1003pco_B mol:protein length:795 Phenylalanyl-tRNA synthetase, beta chain  ali model follow..  12  495.............................................................................LKRVKTLLNDKGYQEVITYSFVDPKVQQMIHPGVEALLLPSPISVEMSA-MRLSLWTGLLATVVYNQNRQQNRVRIFESGLRFVPDTQAPLGIRQDLMLAGVICGETVDFYDLKGDLESVLDLTGVEFRAEANPALHPGQSAAIYLKGERIGFVGVVHPELERKLDLNGRTLVFELEWNKLA------DRVVPQAREISRFPANRRDI 710
75 -10.0003qne_A mol:protein length:485 Seryl-tRNA synthetase, cytoplasmic  ali model follow..  17  191............................................................................LINYGLSFLSSKGYVPLQAPVMMNKEVMAKTAQQFDEELYKVIDGEDEKYLIATSEQPISAYHAGEWFESPAEPVRYAGYSSCFRREAGSHGRVHAFEKIEQFVLKSWEEFDRMIGCSEEFYQSLGLPYRVVG............................................................................ 338

FFAS is supported by the NIH grant R01-GM087218-01
1 2 4 5 2 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Grynberg M, Godzik A. NERD: a DNA processing-related domain present in the anthrax virulence plasmid, pXO1. Trends Biochem Sci. 2004 Mar;29(3):106-10.