current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 4wm0_D mol:protein length:50 Coagulation factor IX, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40
1 -25.9004wm0_D mol:protein length:50 Coagulation factor IX  ali model  100  1MDIVDGDQCESNPCLNGGSCKDDINSYECWCPFGFEGKNCELLE 44
2 -22.2001f7e_A mol:protein length:46 PROTEIN (Blood Coagulation Factor VII)  ali model follow..  62  1...SDGDQCASSPCQNGGSCKDQLQSYICFCLPAFEGRNCETH. 40
3 -21.5001whe_A mol:protein length:86 COAGULATION FACTOR X  ali model follow..  61  43.KYKDGDQCEGHPCLNQGHCKDGIGDYTCTCAEGFEGKNCEFS. 84
4 -19.9001fsb_A mol:protein length:40 P-SELECTIN  ali model follow..  35  2......ASCQDMSCSKQGECLETIGNYTCSCYPGFYGPECEYV. 38
5 -19.5001fax_L mol:protein length:96 FACTOR XA  ali model follow..  60  1..YKDGDQCETSPCQNQGKCKDGLGEYTCTCLEGFEGKNCELF. 41
6 -18.6004bdw_A mol:protein length:85 COAGULATION FACTOR XIIA HEAVY CHAIN  ali model follow..  34  42..RLASQACRTNPCLHGGRCLEVEGHRLCHCPVGYTGPFCDVD. 82
7 -18.4001pfx_L mol:protein length:146 FACTOR IXA  ali model follow..  83  44.QYVDGDQCEPNPCLNGGLCKDDINSYECWCQVGFEGKNCELD. 85
8 -18.0001nfu_B mol:protein length:195 COAGULATION FACTOR XA, LIGHT CHAIN  ali model follow..  59  38.KYKDGDQCETSPCQNQGKCKDGLGEYTCTCLEGFEGKNCELF. 79
9 -17.6001dan_L mol:protein length:152 BLOOD COAGULATION FACTOR VIIA light chain  ali model follow..  59  43.SYSDGDQCASSPCQNGGSCKDQLQSYICFCLPAFEGRNCETH. 84
10 -17.6001p0s_L mol:protein length:138 Coagulation factor X precursor  ali model follow..  64  46....DGDQCETSPCQNQGKCKDGLGEYTCTCLEGFEGKNCELF. 84
11 -17.2003asi_A mol:protein length:410 Neurexin-1-alpha  ali model follow..  25  181.CEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSTSFSGPLCN... 221
12 -17.0004d90_A mol:protein length:143 EGF-like repeat and discoidin I-like domain-c  ali model follow..  40  93.CQHNINECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYK. 134
13 -16.9004xlw_A mol:protein length:124 Neurogenic locus notch homolog protein 1  ali model follow..  42  76.CEINTDECASSPCLHNGRCVDKINEFLCQCPKGFSGHLCQSG. 117
14 -16.4001hre_A mol:protein length:67 HEREGULIN ALPHA  ali model follow..  35  4.HLVKCAEKEKTFCVNGGECLSNPSRYLCKCQPGFTGARCT... 48
15 -16.0002vj3_A mol:protein length:135 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  45  79.CEVNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQVD. 120
16 -15.9001gk5_A mol:protein length:49 MEGF/TGFALPHA44-50 CHIMERA  ali model follow..  35  2.SYPGCPSSYDGYCLNGGVCIESLDSYTCNCVIGYSGDRCE... 43
17 -15.9001tpg_A mol:protein length:91 T-PLASMINOGEN ACTIVATOR F1-G  ali model follow..  38  44.HSVPVKSCSEPRCFNGGTCQQALSDFVCQCPEGFAGKSCEID. 87
18 -15.8001egf_A mol:protein length:53 EPIDERMAL GROWTH FACTOR  ali model follow..  32  2.SYPGCPSSYDGYCLNGGVCIESLDSYTCNCVIGYSGDRCQ... 43
19 -15.8005fm9_A mol:protein length:157 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  40  117.CEENIDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCT... 156
20 -15.5005fma_A mol:protein length:154 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  40  114.CEENIDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCT... 153
21 -15.5004gk9_A mol:protein length:279 agglutinin (BOA)  ali model follow..  14  245.......VELYITSGDNGNTFHGSMTYSGEGPIGFRAMALP... 278
22 -15.3003h5c_B mol:protein length:317 Vitamin K-dependent protein Z  ali model follow..  50  2..YKGGSPCISQPCLHNGSCQDSIWGYTCTCSPGYEGSNCELAK 43
23 -15.3001aut_L mol:protein length:114 ACTIVATED PROTEIN C  ali model follow..  29  11..VLPLEHPCASLCCGHGTCIDGIGSFSCDCRSGWEGRFCQRE. 51
24 -14.5005f1a_A mol:protein length:553 Prostaglandin G/H synthase 2  ali model follow..  42  2......NPCCSHPCQNRGVCMSGFDQYKCDCTTGFYGENCSTPE 41
25 -14.4004xbm_A mol:protein length:531 Delta-like protein 1  ali model follow..  42  420.CDDNVDDCASSPCANGGTCRDGVNDFSCTCPPGYTGRNCSAP. 461
26 -14.2004fbr_A mol:protein length:267 Myxobacterial hemagglutinin  ali model follow..  19  29.DKQNVVAL-DIKSDDGGKTLKGTMTYNGEGPIGFRGTLSSAN. 69
27 -13.9001a3p_A mol:protein length:45 EPIDERMAL GROWTH FACTOR  ali model follow..  30  2....GAPSSYDGYCLNGGVAIESLDSYTCNCVIGYSGDRCQTRD 43
28 -13.6001u67_A mol:protein length:600 Prostaglandin G/H synthase 1 precursor  ali model follow..  33  33.....VNPCCYYPCQHQGICVRGLDRYQCDCTTGYSGPNCTIPE 73
29 -12.9003r05_A mol:protein length:1254 Neurexin-1-alpha  ali model follow..  40  191......EEGEGGVCLNGGVCSVVDDQAVCDCSTGFRGKDCS... 226
30 -12.5004cbz_A mol:protein length:312 PROTEIN JAGGED-1  ali model follow..  40  261LCDKDLNYCGTQPCLNGGTCSNGPDKYQCSCPEGYSGPNCEIVD 306
31 -12.3002ygo_A mol:protein length:188 WNT INHIBITORY FACTOR 1  ali model follow..  37  148......QAECPGGCRNGGFCN---ERRICECPDGFHGPHCEGTK 182
32 -12.1003cfw_A mol:protein length:164 L-selectin  ali model follow..  30  116LCYTA--SCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQ... 154
33 -11.9003ltf_D mol:protein length:58 Protein spitz  ali model follow..  37  9......ETFDAWYCLNDAHCIADLPVYSCECAIGFMGQRCE... 47
34 -11.8001gl4_A mol:protein length:285 NIDOGEN-1  ali model follow..  21  2.P-LAQQTCANNQCSVHAECRDYATGFCCRCVANYTGN...... 39
35 -11.8003u7u_G mol:protein length:55 Neuregulin 1  ali model follow..  42  16.............CVNGGECLSNPSRYLCKCPNEFTGDRCQ... 48
36 -11.5001p9j_A mol:protein length:54 chimera of Epidermal growth factor(EGF) and T  ali model follow..  35  16.............CLHDGVCIEALDKYACNCVVGYIGERCQ... 45
37 -11.3001ivo_C mol:protein length:53 Epidermal growth factor  ali model follow..  35  14.............CLHDGVCIEALDKYACNCVVGYIGERCQ... 43
38 -11.0004xl1_B mol:protein length:230 Delta-like protein  ali model follow..  31  194....DQPICLSGCHEQNGYCSK---PDECNCRPGWQGPLCNE.. 228
39 -10.9002vj2_A mol:protein length:169 JAGGED-1  ali model follow..  42  120LCDKDLNYCGTHPCLNGGTCSNGPDKYQCSCPEGYSGPNCEI.. 163
40 -10.6002k2s_B mol:protein length:61 Micronemal protein 6  ali model follow..  44  14........CSSNPCEAAGTCKETNSGYICRCNQGY......... 42
41 -10.2004xlw_B mol:protein length:261 Delta-like protein  ali model follow..  32  193....DQPICLSGCHEQNGYCSK---PDECNCRPGWQGPLCN... 226
42 -9.8504bxs_A mol:protein length:423 FACTOR X-LIKE PROTEASE  ali model follow..  60  43.VYVDGDQCSSNPCHYRGICKDGIGSYTCTCLSGYEGKNCERVL 85
43 -9.2905e6v_A mol:protein length:224 Integrin beta-2  ali model follow..  25  186.CRCRDQSRDRSLCHGKGFLECG----ICRCDTGYIGKNCEHHH 224
44 -9.1602pe4_A mol:protein length:424 Hyaluronidase-1  ali model follow..  21  333..TSGALLCSQALCSGHGRCVRRAVEFKCRCYPGWQAPWCERKS 414

FFAS is supported by the NIH grant R01-GM087218-01
1 2 2 3 4 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.