current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 1v7o_A mol:protein length:165 alanyl-tRNA synthetase, from PDB1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .
# Score Template Links and tools%idFirst MYSIEVRTHSALHVVKGAVVKVLGSEAKWTYSTYVKGNKGVLIVKFDRKPSDEEIREIERLANEKVKENAPIKIYELPREEAEKMFGEDMYDLFPVPEDVRILKVVVIEDWNVNACNKEHTKTTGEIGPIKIRKVRFRKSKGLLEIHFELLELENPSLELast
1 -66.400[R] COG2872 Predicted metal-dependent hydrolases related to alanyl-tRNA synthetase HxxxH domain  ali follow..  28  100.RYRHMRMHTATHVIANVIEKEAGAQIT---GNQLGLDKSRVDFSL-EAFDRDKFAEYEKIANKVITENHPVNLYLVSRKEAEEKLSRLTTLAKGFSEEISEVRLVEIEGITIEACGGTHLKNTGEIKGIKIEKLQ-NKGKSNRRMYFTLLD....... 245
2 -55.900[J] COG0013 Alanyl-tRNA synthetase  ali follow..  23  559.RAAVVKNHTATHLLHAALHNIVGNHALQAGS-LNEVEFLRFDFTHFAQVTKEELAEIERQVNEVIWQSLKVETVETDIATAKEMGAMALFG----EKYGKNVRVVKIGDYSIELCGGTHTQTTSEIGLFKIVK-EEGIGSGVRRIIAVTGQKAYEAFK 710
3 -52.000[R] KOG2105 Predicted metal-dependent hydrolase, contains AlaS domain  ali follow..  18  118.RFDHMQQHSGQHLITAVADHLFKLKTT---SWELGRFRSAIELDT-PSMTAEQVAAIEQSVNEKIRDRLPVNVRELSLDDPEVEQVSG---RGLPDDHAGPIRVVNIEGVDSNMCCGTHVSNLSDLQVIKILGTE-KGKKNRTNLIFLSGNRVLKWME 267
4 -47.900[J] KOG0188 Alanyl-tRNA synthetase  ali follow..  20  597.RWLTMKNHSATHALNHCLLQVLGKDTEQKGS-LVVPEKLRFDFNSKAAMTIEQVSKTEQLTKEMVYKNVPIYAKESKLALAKKIRGLRSV-----EVYPDPVRVISFGQTSVEFCGGTHLRRSGHIMDFVISS-EEAIAKGIRRIVALTGPEALKALK 765
5 -19.100[J] COG0441 Threonyl-tRNA synthetase  ali follow..  17  73........HSCAHLLGHAIKQLWPHTKMAIGPVI--DNGFYYDVDLDRTLTQEDVEALEKRMHELAEKNYDVIKKKVSWHEARETFANKVSILDENIAHDDKPGLYFHEEY-VDMCRGPHVPNMRFCHHFKLMKTAGAYWRG................. 208
6 -17.200[J] KOG1637 Threonyl-tRNA synthetase  ali follow..  18  124........HSSAHIMGEAMERIYGGHLCYGPPI---ENGFYYDMHLGEGISTNDYGAMEGLVKQIVKEKQNFERLEMKKSDLLEMFKYNEFKVRILNETTDRTTVYKCGSL-IDLCRGPHVRHTGKVKALKITKNSSTYWEG................. 256
7 -5.740[J] KOG2364 Predicted pseudouridylate synthase  ali follow..  10  318..............VVSLTRVPRDVSEKLCVGEEDKRKQYCAYCYSILPISDSQFTAAQSKIPLKIVQKTPVRVMKRRALLDRE-------------RWIYSMNFLKLDDVRLETQAGTYIKEHGDFGRTR............................ 427
8 -5.700[A] KOG4209 Splicing factor RNPS1, SR protein superfamily  ali follow..  15  28...................................................EGDLNEIEEEQKKLKAIQNEMVGHMNLNTSSQSNSSQS--LLTPEEKAEADAKSVYVGNVDYGA---QHFHGCGSVSRVTIQCDRSGHPKGFAYVEFTEKEGMQNALA 137
9 -5.540[K] KOG4210 Nuclear localization sequence binding protein  ali follow..  14  189.....................................................FFKNVEQMKAVLELSESHLNGRNMLIKDSENYSGRPDKDDLVAMSKNPPSRILFVGNLSFDV---KHFQHCGDIVKIRMATFESGKCKGFAFIDFKNEEGSTNELK 298
10 -5.390[A] KOG0128 RNA-binding protein SART3 (RRM superfamily)  ali follow..  592.ARTIFVSNLDFTTTEDEIRQAIEGVASIRFARKANSDLVHRGFAYVVMENDQKAQQALLK-DRVPVKGRPMFISANDPEKRVGF-------KFSTTLEKSKVFVRNVHFQATDDELKALFSKFGTVTSVRRVTHKDGKPKGIAFVDFDTEASAQKCVA 741

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 2 5 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Grynberg M, Jaroszewski L, Godzik A. Domain analysis of the tubulin cofactor system: a model for tubulin folding and dimerization. BMC Bioinformatics. 2003 Oct 10;4(1):46.