current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 3a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase, from PDB1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .
# Score Template Links and tools%idFirst MGSSSSGLVPRGSHMSETASWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGPGHSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPLSADKTQLREVAAKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGKEKPTFVYHFPASQASLAQISTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQHPIDQNLIEALKVGMPDCSGVALGVDRLVMLALGAETLAEVIAFSVDRALast
1 -134.000[J] COG2269 Truncated, possibly inactive, lysyl-tRNA synthetase (class II)  ali follow..  60  24PPMTNSD-------------WMPTASISQLKQRATLLRQIREFFAERNVLEVETPAMSHATVTDIHLHTFKTEFVGPGYAKGSALHLMTSPEFHMKRLLAAGSGCIYQLGKAFRNEENGRYHNPEFTMLEWYRIGFDHHALMDEMDALLQLVLRCGSAERMTYQEAFLNVLGVCPLEEEMRELKQVAATLGLSDIAEPEEDRDTLLQLLFSIGIEPKIGQITPAFVYDFPASQAALAKINPADPRVADRFEVYFKGIELANGFHELDNPAEQLARFKADNAKRLEMGLTEQPIDYHLIAALEAGLPECAGVALGIDRLIMLALGEDHIDKVTAFPFPRA 349
2 -102.000[J] COG1190 Lysyl-tRNA synthetase (class II)  ali follow..  28  158HGLADQETRYRQRYLDLIAN---DESRHTFKVRSQVMSGIRSFMVEKGFMEVETPMMQV-IPGGASARPFVTH----HNALDIDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGVSPRHNPEFTMMELYMAYADYKDLIVLTEELFRTLTEGKPFAKLTMKEAICKYRPETNVADLDDMDKAVAIAESLGIKVEKSWGLGRIQCEIFEETAESHL--IQPTFITEYPAEVSPLARRNDDNPFITDRFEFFIGGREIGNGFSELNDAEDQAQRFADQVSAKEAGDDEAMFYDEDYITALEHGLPPTAGLGIGIDRMVMLFTNSHTIRDVILFPAMR. 502
3 -98.100[J] KOG1885 Lysyl-tRNA synthetase (class II)  ali follow..  25  218FGLKDKETRYRQRYLDLILN---DFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNI-IPGGAVAKPFITY----HNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKTPPFRRINMVEELEKALGMKLPETNLFETEETRKILAKAVECPPPRTTARLLDKLVGEFLEVTC--INPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMK. 574
4 -73.800[J] KOG0556 Aspartyl-tRNA synthetase  ali follow..  16  229FVRVNLDTRLDNRVLDL----RTPTNQAIFDIQAGICQAFREFLLSNSFNEIHTPKMSGA-SSEGGSNVFKIQY------FKTDGFLSQSPQLYKQMLIAADRERVFEIGPVFRAEDSNTRHMTEFTGLDLEMAFNEYHEVMEFIEKLFLYIFKDADRIRFHFKDAVKLLKEAGYRKQLVPGQKVPEDEEFHYCEDPEFDDFSTPEERALGQIVREKYH-TDFYVIDKYPSSVRPFTMPDPEDPRYSNSYDFFMKGQEIMSGAQRIHDPELLVERMKALGVSPDVG-------LQQYIDAFAIGCPPHAGGGIGLERVVMFYLNLPNIRLASSFPRDP. 575
5 -67.900[J] COG0017 Aspartyl/asparaginyl-tRNA synthetases  ali follow..  14  108...HGTEFLMDHRHLWL----RSKKQHAVMKIRNEVIRATYEFFNKDGFTKVDPPILTAS-APEGTSELFHTKY------FDQDAFLSQSGQLYLEAAA-MAHGKVFSFGPTFRAEKSKTRHLIEFWMIEGEMAFTNHAESLEIQEQYVTHVVKSVLENCKLELKILERDTSKLEKVATPFPRISYDDAIELKAEGFDDIEWGEDFGAPHETAIANHYD--LPVFITNYPTKIKPFMQPNPENEETVLCADLIAGYGEIIGGSERVDDLELLEQRVKEHGLDEEA---------SYYLDLRRYGSVPHCGFGLGLERTVAWISGVEHVRETAPFPRLLN 426
6 -66.300[J] KOG2411 Aspartyl-tRNA synthetase, mitochondrial  ali follow..  20  1.........................MQYNLRLRSQMVMKMREYLNLHGFVDIETPTLFKRTPGGA--KEFLV----PSREPGKFCSLPQSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVDQTGIQSLIEGLLQYSWPNVPFPTMTFAEVLATYGTDKPFGMKIIDISDVFRNTEIGFLQDALSKPHGTVKALFLPKEESPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILAT-------LLKEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFR 427
7 -66.000[J] COG0173 Aspartyl-tRNA synthetase  ali follow..  19  115.ENISENVRLTNRVIDL----RRPVMQRNLRLRYQVAMGVRRYLDAQGFIDIETPMLTRSTPEGA-----RDYLVPSRVHPGEFFALPQSPQLFKQLLMVAGFDRYYQITKCFRDEDLRADRQPEFTQIDLETSFLNEDEIMDITEGMAKQVFKDGDFPRMPYSEAMFYYVVNEAIGALRIKVGLEHGKDNGYFTDEWKPLWVVDFPMFEYDEEADRYVAVHHPF--TAPKEGHEDLMVSDPANCLARAYDMVLNGWEIGGGSIRIHRADVQEKVFAALKI----SPEEQQEKFGFLLDNLKFGAPPHGGLAFGLDRLVTLMTGAESIRDVIAFPKTQR 568
8 -65.400[J] KOG0554 Asparaginyl-tRNA synthetase (mitochondrial)  ali follow..  14  203.KKRVSREFLRTKAHLRPRT---NTFGAVARVRNTLAYATHKFFQESGFVWVASPIITAS-DCEGAGEQFCVTTLISQDFFGKPAFLTVSGQLN-GETYATALSDVYTFGPTFRAENSNTRHLAEFWMIEPELAFADLDDDMACATAYLQYVVKYVLDNCKEDMEFFDTWIEKGIIRRLSDVAEKEFLQLGYTDAIEFPVKWGLDLQSEHERYITEEAFGGRPVIIRDYPKEIKAFYMRENDDGKTVAAMDMLVPRIGELIGGSQREERLEVLEA-------RLDELKLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFVTGIDNIRDVIPFP.... 559
9 -61.000[J] KOG0555 Asparaginyl-tRNA synthetase  ali follow..  16  218.ESAGVDVMLDNRHLVI----RGENASRILRIRAAATRAMRDHFFAAGYTEVAPPTLVQT-QVEGGSTLFGLDY------YGEPAYLTQSSQLY-LETCNAALGDVYCISQSYRAEKSRTRHLSEYQHVEAECAFITFDQLMDRIEALVCDTVDRLLADLIEFVNPGYKAPARPFKRMPYKEAIEWLQKNDVRNEMGEKFVYGEDIAEAAERRMTDTIG--VPILLNRFPHGIKAFMPRCADDNELTESVDLLMPGVEIVGGSMRIWKEDQLLAAFEKGGLDSKN--------YYWYMDQRKYGSVPHGGYGLGLERFICWLTDTNHIRDVCLYP.... 537
10 -35.600[E] COG2502 Asparagine synthetase A  ali follow..  12  7.......................LQQQEISFVKNTFTQNLIEQL---GIIEVQGPILSQVGNGDNLSGIEKAVQVNVKCIPNAVFEVVHSLAKWKRHTLAKEDEGLFVHMKALRPDELDPTHSVYVDQWDWEKVIPEGRRNFAYLKETVNSIYRAIRLTELAVEARFDIPSIL-PKQITFVHSEDLVKRYPDLSSKERENAICKEYGAVFLIGIGGKLSDGKPGRAPDYDDWTTESENGYKGNGDILVWNDQLGKAFELSSMGIRVDESALRLQVGLTGDEDHLKMD---------HQDLLNGKLPLTIGGGIGQSRLAMLLLRKKHIGEVQVWP.... 319
11 -12.500[J] COG0016 Phenylalanyl-tRNA synthetase alpha subunit  ali follow..  16  111.................................TATITEVEDLFIGLGFSVAEGPQIETD-----NFEALNLPKDHPARDMQDSFYFSPVQARTMEKYKGKGPIKIICPGKVFRRDDDDATHSHQFMQIEGLYVDHGVR--MSDLKGVLQAFAKSFFGEERSIR-----------------------------------------LRPSFFPFTEPSV---------EVDVSCGICHGDGCRVCKQTGWIEILGAGM-----------------------------------VHPRVLEMSGFNPNEYSGFGMGVERLSMLKYGIDDIRHF........ 330
12 -12.300[J] COG0124 Histidyl-tRNA synthetase  ali follow..  11  15...........................GDVETWQWIEQKAYDLCRRYNYQEIRVPMFEHT-GVGDTTDIVQKEMYTFEDRGGRSLTLRPEGTASVTRAYVSN--KLFYIGPMFRYERPQSGRMRQFVQFGVEALGSADPAIDAEVLALVMRFYEELGLKNLKLV--INSLGDTDSRLAHREALVNHFKPRIHEFCNDCQDRLEKNPLRILDCKKDRD------ELMGTAPSIHDYLSTESKAYFEKVQSY--FVVDATLVRGLDYYNHTA-----FEVMVDGEGFGAITTL---NGLVEEIGGPETPGIGFALSIERAIMALEAQQ............. 321
13 -11.500[J] KOG1936 Histidyl-tRNA synthetase  ali follow..  12  69...........................QHMVVREKILDLVISCFKRHGAKGMDTPAFELKETLTEKYGEDSGLMYDLKDQGGELLSLRYDLTVPFARYLAMN--KRYHVGKVWRRE------SPTIVQ-EFCQCDFDIAECLKIMCEILSGLQLGDFLIKVNDRRIVDGMFAFRAICSSIDKLDKMAWKDVRHEMVVKKGLAPEVADRIGDYVQCHGGVSLVEQMFQDPRLSQNKQALEGLGD-GIADKISFLARGLDYYTGYEAVLLQTPTQAGEEPLNVGSVAAGGRYDGLVGMFDPKGHK---PCVGLSIGVERIFYIVEQRMKTKG......... 402
14 -10.800[E] COG3705 ATP phosphoribosyltransferase involved in histidine biosynthesis  ali follow..  11  16...........................TNARQLESAREQLLALFRVHGYELVQPPLMEHSLLTHIDAGLSLKTILVTDRLSGRQLGIRADITPQVARIDAHLLSRLCYAGPVLHAQSDGLLNMREPLQAGAEMYGFA--ELIDLMLKSMKIADMGKVLLSLGHIGIFRALSDAHLDAGQSATLLALMQDKDTETVEAQVKAWKKAFSLLPRLYGGREVLSDARGRLPDLSAVGGALGELQA-DLSELRVDN-YHTGLLYAAYAADFHDAVARGGRY------------------DGLGGYFGRARP-ATGFSFDLRSFIGRLPAIERQPAVLV...... 331
15 -10.600[J] KOG2324 Prolyl-tRNA synthetase  ali follow..  12  21...YNVPESANQLLIDMGFIQPSMPGIFQYRVQNKICDLLHISMRSLGASAISLAHLSSKEIKSGRWQKTGSELFRLHDRNDREMCLAPTHEEDVTRTMATIIDRVYQIGRKFRDERGGLLRGREFMMKDLYTFDIDKASAMKTYEDVLQAYHTFFKEVGLPFVMVKAATGNIGGNLSHEFHYRHPVGEDVIYTCPSCHYSTNS--------------------------EMLDLSKTSSDISCPNCNDQLTSTTAIEVGHAFY---------KIYSSKFNATVEVKNKQEVLHM-------------GCYGIGVSRLIAAVAHVTKDAKGLVWPSSIA 327
16 -10.500[J] KOG2784 Phenylalanyl-tRNA synthetase, beta subunit  ali follow..  13  284.................................MKVRSEFRQIFFSMGFSEMDTFFVSDPAISTKFPEDYLERVKTVHSEEAQKNVLRTHTTAVSARQLYQLAQKLFSIDRVFRNETLDATHLAEFHQVEGVIAEKNLS--LAHLIGIFTEFFKKLGITNLRFKPTY-------------------------------------------------------------NP--TEPSMEIFAYHQGLTKWVEIGNSGM-----------------------------------FRPEMLLPM--GLPA--GYGLSLERPTMIKYGINNIRDL........ 532

FFAS is supported by the NIH grant R01-GM087218-01
1 3 1 7 4 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Schwarzenbacher R, Godzik A, Jaroszewski L. The JCSG MR pipeline: optimized alignments, multiple models and parallel searches. Acta Crystallogr D Biol Crystallogr. 2008 Jan;64(Pt 1):133-40. Epub 2007 Dec 5.