current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 5Z0B Entity 1(prereleased), from PDB1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .
# Score Template Links and tools%idFirst DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQXPFEDHVKLVNEVTEFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVDETYVPKEFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVEKCCKADDKETCFAEEGKKLVAASQAALGLLast
1 -9.380[IG] KOG1340 Prosaposin  ali follow..  10  438.....TLCEYMLHFIQETLAT------------------PSTDDEIKHTVENICASGVAGQCVEMYGDAVIALLVQGLNPRDVCPLMQMCCPL-------CLFAVEQAQMKIRDNKSKDNNGLCSHLPNEIKEECVDFVNTYS--------NELIDMLITDFKPQEICCPKTTYALWDLRISLEDDVDGEDKSSSEEISFNDIESL---------------------EELPPQLAFDPGFTAAPNCL---EELVKTLEKRMGKHPTRDSIKHILEESCDRMRKPMNTKCHKVIDKYGDKIADLLLKEM--DPKLICTELGMCILADLDDLEVDEALKYDVIALPRQDNKLSSSIKEPPTC------VLC---------------EFIMTKLDADLKNKTEQDDIKRAIEAVCNRLPATVRKQCDTFVDGYASAVLKLLSDVPPKQV-CQK--------QLCFSVAVTDEVLECGVC--------HGVTQALLPFLREKKDNVSEVTALQ-SVGCENLPAKYYKICSEMISIYGSS-------IKNLAKRPYIDQSHICCFESEKSS................... 945
2 -7.610[T] KOG4296 Epithelin/granulin  ali follow..  4.................................................................................................................................................................................................................................................................SQINQNSKHITKKNDVRIFFCILYFNIKYFSFTFIAELDQTIIIIDRQVVSDKIGVLSVCPLHSSFSFIFSIKIMRLILLFLAVFLCRVTAHQCDAETECSDCCPMPNAVCCDDRS------HCCPTGTTCDPQGARCIGADEKHVPMKKKKPARKTVERNQFNEVVCPDKASKPDGSTCCLLEQGSYGCCPVPN-----AVCCADM---------LHCC----PNGFTCHGQFCSQNFAMIPHLRKFASTSIHRKPAVEFLSEEEEDDDDEESTSSEDPESDVDPIANVRGKNGEPKTMCCPLSNFNFR.................. 318
3 -7.160[S] KOG4623 Uncharacterized conserved protein  ali follow..  12  42...................................................................................................................................................................................................................................................................................................................................................................................................................................................NCCNGQDRNSWTC----------PSCEQYNGFTKDGDYNRDITSQRDCSLG--SSSICANSYYSDVLTAQPPAPKNGLCDQCNEAQ-RLKVEKLSQFEPKNESRFDQELKVYRERLEKQFRLC------SSCERHVNKVLHEKKKMVLS. 187
4 -7.040[S] COG5469 Predicted metal-binding protein  ali follow..  14  17....................................................................................................................................................................................................................................................................................................................................................................................................................................................CCASVWQDGKRVGESGGQKLLNQLQQLAQEWELRDKFP-------IQEVECMSA-----------------------CNRSCVVAFTGKGKLTYLFGDLAVDDHASAVLECAGKYYDKADGLLPWSERPEPLKKG.............. 123
5 -6.870[S] COG4461 Uncharacterized protein conserved in bacteria, putative lipoprotein  ali follow..  11  26.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................SPTAGQSLDC---------------TKPATIVQQLVCHDRQLTSLDHRLSTAYQQALAHRR--SAALEAAQSSWTMLRDACAQDTDPRTCVQEAYQTRLVQLAIADP. 115
6 -6.830[O] KOG4400 E3 ubiquitin ligase interacting with arginine methyltransferase  ali follow..  12  65..................................................................................................................................................................................................................................................................................................................................................................RRLRRINQRNRDKFCFACRQQGHIVQDCPEAKDNVSICFRCGSKE--------------------------------HSLNACSKKGPLKFAKCFICHENGHLSGQC-EQNPKGLYPKGGCCCSSVHHLAKDC.................................................................................................. 166
7 -6.800[R] KOG3511 Sortilin and related receptors  ali follow..  10  578...................................................................................................................................................................................................................................................................................................................................................................................................................ARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTI-GCILGYKEQFLSSVCQNGRDYVVTKQPSICCSLEDFL---CDFGYYRPE--------------NDSKCVEQPE----------LKGHDLEFCLYGREEHLTTNGYRKIPGDKCQKDLKKKCTSNFLSPEKQNSKSN... 755
8 -6.440[S] KOG3136 Uncharacterized conserved protein  ali follow..  23....................................LRVSAIRKDIGFLEERSCRTTVQ----RYLISDDEGNVCDALSLESRT-----RCCPWKGERFSC--------------------HGC--------------------------------------NILSQCCNSYEFSCCLNPSQTLLEKVVKVKVAKPATSGTYKSVFDFCAGRCRHNSESVVHENATRLLGIDVIVGSQGDSCDAVCKSRGQLCVMNKLSLLNQ-CLASAGPGHNHCFPVTVHTNTPDDS........................................................................................................................................................................................................................................................................................................ 267
9 -6.190[S] KOG4367 Predicted Zn-finger protein  ali follow..  1..............................................................MEEMEEELKCPVCGS-----REPIILPCCQA-------CARNILVQTPESESPQSHRAAGSGVSDYDYLDLDKMSLYSE--------ADSGYGSYGGFASAPTTPCSPNGVRVFPPATHLSPALAPVPRNSCITCPQCHRSLILDDRGLRGF---------KNRVLEGVIDRYQQSKAAALKCCEKAPKEATVMCEQCDVFYCDP-----------CRLRCHPPRGPLAKHR---PPAQGRVSRRLSPRKVSTCTDHELENHSM---------------------------------CCKMPVCYQCWKLHKSQLSQALNGLSDRAKEAKEFLVQLRNMVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVRDQISHCTVKLRQTTGLMEYCLEV................................................................................................................ 373
10 -6.050[W] KOG3658 Tumor necrosis factor-alpha-converting enzyme (TACE/ADAM17) and related metalloproteases  ali follow..  10  240...FVRTCSLYEHIRMKEGNNNHIKAVNEIYEGTNFNGIKGLHFVIQRTSIYTPDSCDRGRAKTDSDNPFCEENVDVSNFLNLNSQRNHCLAYALTFR--DFVGGTLGLAWVASPQFNTAGGICQVHQRYNEGSRGWIVTLVNYGNRVPARVSQLTLAHEIGHNFAECQPGLPDGNFIMFASATSGDKPNNGK----SPCSVKN----SAVLAVVLKSMPVDPTRNASPVGIGKRNCFQERTSAFCGNQIYEPGEE--------CDSQADCDQMGDKCCVPHEARGGPC-------------------KRKPGAQCSPSQG-------------------------------------YCCNPDT---CSLHGKNEEKICRQESECSNLQTCD--------------------------------------GRNAQC-SPPKHDGIPCQDS------TKVCSS----------GQCCAMFGLE--DCFLTEGKADE------------LCFLACIKDGKCTSSVHLPEFSANRTNFLQNMRKDKPGLI-------SPCCDIFRK--CRSVDANGPLARLKNLL.. 729

FFAS is supported by the NIH grant R01-GM087218-01
1 3 2 7 5 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Doctor KS, Reed JC, Godzik A., Bourne PE. The apoptosis database. Cell Death Differ. 2003 Jun;10(6):621-33. Review.