current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 1v7o_A mol:protein length:165 alanyl-tRNA synthetase, from PDB1018

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .
# Score Template Links and tools%idFirst MYSIEVRTHSALHVVKGAVVKVLGSEAKWTYSTYVKGNKGVLIVKFDRKPSDEEIREIERLANEKVKENAPIKIYELPREEAEKMFGEDMYDLFPVPEDVRILKVVVIEDWNVNACNKEHTKTTGEIGPIKIRKVRFRKSKGLLEIHFELLELENPSLELast
1 -55.800IDP05710 gene: alaS; alanyl-tRNA synthetase [Staphylococcus aureus subsp. aureus COL] SACOL1673 [Staphylococcus aureus subsp. aureus COL]  ali follow..  23  558.RRDIQKNHSATHLLHAALKSVLGDHVNQAGS-LVEADRLRFDFSHFGPMTNDEIDQVERLVNEEIWKGIDVNIQEMDIASAKEMGAMALFG----EKYGDVVRVVNMAPFSIELCGGIHVRNTSEIGLFKIVS-ESGTGAGVRRIEALTGKAAFLYLE 709
2 -55.800IDP05327 gene: alaS; alanyl-tRNA synthetase [Listeria monocytogenes EGD-e] lmo1504 [Listeria monocytogenes EGD-e]  ali follow..  21  559.RRETIKNHTATHLLHRALKDTLGEHVNQAGS-LVSPDRLRFDFSHFGQITEEELTKMEEIVNEKIWEQINVVIEEMPIAEAKELGAMALFG----EKYGDIVRVVQVGKYSIELCGGVHVRNTADIGLFKIVS-ETGIGAGTRRIEAVTGKEAYRFVT 710
3 -54.800IDP04730 alanyl-tRNA synthetase [Bacillus anthracis str. Sterne] BAS4284 [Bacillus anthracis str. Sterne]  ali follow..  23  560.RSSVVKNHTATHLLHQALKDVLGTHVNQAGS-LVTSERLRFDFSHFGQVQADELEKIERIVNEKIWESIDVEISQKAIEEAKEMGAMALFG----EKYGDVVRVVQVGDYSLELCGGCHVDNTASIGIFKIVA-ESGIGAGIRRIEAVTGKSAYELMN 711
4 -53.900IDP90826 gene: alaS; alanyl-tRNA synthetase [Yersinia pestis CO92] YPO3305 [Yersinia pestis CO92]  ali follow..  21  557.RNRIRLNHSATHLLHAALRNVLGEHVAQKGS-LVNDKYLRFDFSHFEAMKPEQIRLVEDLVNEQIRRNMPVQTEVMELDAAKEKGAMALFG----EKYDDQVRVLTMGDFSTELCGGTHASRTGDIGLFRILT-ESGTAAGIRRIEAVTGEGAIALLH 708
5 -51.400IDP90679 gene: alaS; alanyl-tRNA synthetase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0506 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  23  542.REQIARHHSATHLLHHALREILGSHVSQAGS-LVESNKLRFDFTHHKALNKEELESIEKRVNKMIINSSEAILENMPLEEAKKSGAIALFN----EKYQGNVRVLTL-GESKELCGGTHVKNTAQIGSFYIVK-ESGVSAGVRRIEAVVSKAALEFVK 692
6 -44.900IDP92131 alanyl-tRNA synthetase, putative [Toxoplasma gondii ME49] TGME49_019540 [Toxoplasma gondii ME49]  ali follow..  14  633.RFRLAQHHTGTHLLNFALREVLIRKLRSGGGSLVEVKRLRFDYAGEKPLENEDIIAVENVVKDCIAQARPVHYKEVPLEQAMKIPGLRAV-----EVYPDPVRVVSVGEASIELCGGTHLHNASQLSDFCILS-EESVAKGVRRVVAAAGDAAFEARK 840
7 -21.400IDP90668 gene: thrS; threonyl-tRNA synthetase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0206 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  16  42........HSCAHLMAQAIKSLYPEAKFFVGPVI--EDGFYYDFRVESKIGEEDLVKIEKKMKELAEAKIEISKYEITKSEALAKFQNDDLKQEVLLRIPDRAVSIYKQGEFEDLCRGPHVPNTKFLRFFKLTRVAGAYLGG................. 173
8 -21.200IDP05712 threonyl-tRNA synthetase [Bacillus anthracis str. Sterne] BAS4472 [Bacillus anthracis str. Sterne]  ali follow..  21  76........HSTAHLLAQALKRLYKDVKVELGIGPVIENGFYYDIDMEEAITVEDFKKIEKEMQKIVNENLEIVRHEVPRAEAIRRFEEI-LKLDLINDEDAVISIYEQGEF-FDLCRGVHLPSTGKIKVFKLLSVAGAYWRG................. 212
9 -19.400IDP90813 threonyl-tRNA synthetase [Vibrio cholerae O1 biovar eltor str. N16961] VCA0287 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  16  74........HSCAHLLGHALKQLYPNAKMAIGPTI--DSGFYYDIDLEQSLSQEDLEKIEARMVELAKTKYAVVKKKVSWQEARDTFESKMEILDENVARDDRPGLYHHEEY-IDMCRGPHVPHMGFCQNFKLLNIAGAYWRG................. 209
10 -19.300IDP90770 gene: thrS; threonyl-tRNA synthetase [Yersinia pestis CO92] YPO2433 [Yersinia pestis CO92]  ali follow..  14  73........HSCAHLLGHAIKQLWPDTKMAIGPVI--DNGFYYDVDIEHTLTQEDLALLEKRMHELADKDYDVIKKKVSWQEARDTFAAKVAILDENISRDDRPGLYHHEEY-VDMCRGPHVPNMRFCHHFKLQKTSGAYWRG................. 208
11 -19.200IDP92018 threonyl-tRNA synthetase, putative [Toxoplasma gondii ME49] TGME49_100260 [Toxoplasma gondii ME49]  ali follow..  17  228........HSSAHILGQAIEATFGAQLTVGPAL---TNGFYYDAYMDAKVTEESYGRLEAAAAAVIKEDQAFRRLVCSKAEALELFADNPFKVQLIASKIGLTTVYCCGSL-VDLCRGPHIPSTGKVKAFQVIKHSASYWLG................. 361
12 -18.100IDP06155 gene: thrS; threonyl-tRNA synthetase [Helicobacter pylori J99] NP_222834 [Helicobacter pylori J99]  ali follow..  18  52........HSCAHLLAQSLKALYPDAKFFVGPVV--EEGFYYDFKTTSKISEEDLPKIEAKMKEFAKSKLAITKETLTREQALERFKGDELKHAVMSKISGDIFGVYQQGEFEDLCKGPHLPNTRFLNHFKLTKLAGAYLGG................. 183
13 -17.700IDP05080 gene: thrS; threonyl-tRNA synthetase [Listeria monocytogenes EGD-e] lmo1559 [Listeria monocytogenes EGD-e]  ali follow..  22  72........HSTAHLMAQALKRLYPDVKFGVGPAI--ESGFYYDIDTEAVISDESLVEIEKEMQKIVRENVPIEREVVSREEAIKRFKAI-LELIEAIPEDETVTIYTQGEF-FDLCRGVHVPSTGKIQVFKLLSVAGAYWRG................. 206
14 -17.500IDP05335 threonyl-tRNA synthetase [Bacillus anthracis str. Sterne] BAS2222 [Bacillus anthracis str. Sterne]  ali follow..  22  77........HSAAHILAQAVKRLYGDINLGVGPVI--ENGFYYDMDLPSSVNVEDLRKIEKEMKKIINENIKVERVEVSREEAAKLFQEMNDRLKLE-PSGESVTLYKQGEF-VDLCRGPHLPSTGYLKVFQLTHVSGAYWRG................. 211
15 -16.200IDP06315 gene: thrS; threonyl-tRNA synthetase [Streptococcus pneumoniae TIGR4] NP_346071 [Streptococcus pneumoniae TIGR4]  ali follow..  23  73........HSAAHLFAQAARRLFPD-IHLGVGPAIEDGFYYDTDNTAGQISNEDLPRIEEEMQKIVKENFPSIREEVTKDEAREIFKNDPYKLELISEDEGGLTIYRQGEY-VDLCRGPHVPSTGRIQIFHLLHVAGAYWRG................. 207

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 2 3 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rychlewski L, Wilson IA, Lesley SA, Godzik A. XtalPred: a web server for prediction of protein crystallizability. Bioinformatics. 2007 Dec 15;23(24):3403-5. Epub 2007 Oct 5.