current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 3qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase, from PDB1018

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280
# Score Template Links and tools%idFirst MKGGLVPRGSHGASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLTPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLVFWQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSALVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNLLast
1 -45.300IDP90816 gene: hisS; histidyl-tRNA synthetase [Yersinia pestis CO92] YPO2878 [Yersinia pestis CO92]  ali follow..  15  2.................................................AKNIQAIRGMNDYLPADTAI-WQRIESILKQVLSGYGYSEIRMPIVEQTPLFKRAIGEVTDVVEKEMYRNGESLTLRPEGTAGCVRAGIEHGLLYNQEQRLWYIGPMFRYERPQKGRYRQFHQLGAEVFGLPGPDIDAELITARWWRALGIHVKLELNSIGSLAARADYREALVAFLEQHVEVLDEDCKRRMYNPLRVLDSKNPDVQQLLDDAPKLQHFAGLCELLDKASIPY 251
2 -44.800IDP90628 gene: hisS; histidyl-tRNA synthetase [Vibrio cholerae O1 biovar eltor str. N16961] VC0760 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  12  2.................................................AKTIQAIRGMNDCLPTQSPL-WQKVEGVVKNVISAYGYSEVRMPIVEMTHLFSRAIGEVTDVVEKEMYRNGDSLTLRPEGTAGCVRSGIENGLLYNQEQRLWYMGPMFRHERPQKGRYRQFHQCGVEVFGLDGPDVDAELITARLWRELGIHVRLELNSIGSLEARANYRTALIDYLEQYQNVLDEDCKRRMYNPLRVLDSKNPDVQAILGDAPQLQHFAGLCELLDAAGIEY 251
3 -44.500IDP90766 gene: hisS; histidyl-tRNA synthetase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0765c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  15  1...................................................MINALKGMKDLLDKDAYY-YEKVIKICEEVAKNYGFTFINTPHLELCTLFKRSVGESSDIVGKEMYKGENHVCMRPEGTAGVVRAYIEKKDKNTSVKRWFYYGSMFRYERPQKGRLREFHQFGVESLGIPNVYEDASIILVEIFSRLGIDFKLQLNSLGCSQCLPKYRDRLVEFLDSKEGFCEDCLRRKNLNPIRVLDCKNEHCQNLLENAPLLKDFETLQQILKDNGVKF 246
4 -44.400IDP05687 gene: hisS; histidyl-tRNA synthetase [Listeria monocytogenes EGD-e] lmo1520 [Listeria monocytogenes EGD-e]  ali follow..  17  1..................................................MDLQLPRGTRDILPEEVSK-WHFLETEFKNVCENYQYEEIRTPVFEHTELFERGVGDSTDIVSKEMYKGGRSLTLRPEGTASVVRAFVEHKGEVSQPIKMYYNEPMFRYERPQGGRQRQFTQMGIEALGSDDPSIDVEVIAMEFFRKIGLNIKLVINSLGDKESRLKHREALVAHFEPHIDEFCAECQVRLHNPLRILDCKKDHDNPLIQSAPSIAYFENVKNYLNALEIPF 250
5 -32.400IDP04618 phenylalanyl-tRNA synthetase subunit alpha [Bacillus anthracis str. Sterne] BAS4456 [Bacillus anthracis str. Sterne]  ali follow..  14  35.KKGPITE-----VLRGMGKLSAEERPRMGALVNEVREAIQTRLDDKISNLEKAVIEAKLATVETGCHHPLTAVVEQIEDVFIGMGYEVAEGTEVEKD--FEALNLPKDHPARDMQDTITEETLLRTHTSSVQARTMENNKEK--GPIKIICPGKVYRRDDDDATHSHQFMQIEGLVIDKNIRMSDLKGTLQVFVKKMSVEMDISCMMCHGKGCGTCKGTGWIEILGAGMVHPNVLEMAGYDSK-FAFGMGAERIAMLKYGVDDIRHFTNDVRFLQQFK... 342
6 -32.300IDP05680 gene: pheS; phenylalanyl-tRNA synthetase subunit alpha [Listeria monocytogenes EGD-e] lmo1221 [Listeria monocytogenes EGD-e]  ali follow..  16  31..KYLGKKGPMTEIMKQMGKLSAEERPKMGSLANEVRTALTEAISSKQQILETEAINEKLKSPSIGTKHLLTQVIEEMEDMFIGMGYEIAEGPEVELD--FEALNLPKDHPARDMQDSITENTLLRTQTSPVQARTMEKHDFS-KGPIKVICPGKVYRRDNDDATHSHQFTQIEGLVVGENITFADLKGTLTVLAKTMSVEMDISCFKCGGKGCRVCKGTGWIEILGSGMVHPNVLEMSGIDSTGFAFGLGPERVAMLKYAVDDIRHLTNDLRFTKQFQ... 343
7 -31.600IDP92038 phenylalanyl tRNA synthetase isoform, putative [Toxoplasma gondii ME49] TGME49_034500 [Toxoplasma gondii ME49]  ali follow..  17  182....ASPEKALQDLKKRKLVELRKVKYLKLQKGPKFSLHLMKPVADLTAELLIGDAWEKSNFIRRGAVHPLMQVMKQFKQILYCMGFEEMPTPARDVQDTFERGGHGSIGWQYEWSEEESMGNILRTHTTASSARMLYGLAQEYKKPRKFFSIDRVFRNETLDATHLAEFHQVEGLVADRGLTIGHLMGVMETFYKQIGIEQLKFKPAYNPYTEPSMEIKRWIEVGNSGIFRPEMLLPMGLPEDVIAWGLSLERPTMIRYGISNIRQL-----FGHRALLGM 524
8 -30.100IDP90931 gene: pheS; phenylalanyl-tRNA synthetase subunit alpha [Salmonella typhimurium LT2] STM1337 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  15  32....LGKKGHLTLQMTTLRDLPPEERPAAGAVINAAKEQVQQALNARKAELESAALNARLAAETIDGLHPVTRTIDRIESFFGELGFTVATGPEIEDD--FDALNIPGHHPARADHDTFDATRLLRTQTSGVQIRTMKAQ----QPPIRIIAPGRVYRNDYDQT-HTPMFHQMEGLIVDTNISFTNLKGTLHDFLRNFFEEDLQIRPSYFPFTEPSAEVGKWLEVLGCGMVHPNVLRNVGIDPEGFAFGMGMERLTMLRYGVTDLRSFENDLRFLKQFK... 327
9 -29.800IDP90648 gene: pheS; phenylalanyl-tRNA synthetase subunit alpha [Vibrio cholerae O1 biovar eltor str. N16961] VC1219 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  15  34.KKGELTV-----QLQSLGKLPPEERRTAGQEINVAKEAVQKALAERKDALQSAELEAKLAAETIDGLHPVTRTIERIESFFGELGFTVESGPEIEDD--FDALNIAADHPARTDHDTFNPKLMLRTHTSGVQIRTLEER----QPPLRFIAPGRVYRND-YDQTHTPMFHQVEGMLVDENVNFAQLKGILHDFLCNFEDLEVRFRPSYFPFTEPSAEVDKWLEVLGCGMVHPNVLRSVGIDPEGFAFGMGVERLTMLRYGVNDLRAFENDLRFLKQFK... 327
10 -29.400IDP05307 lysyl-tRNA synthetase [Yersinia pestis CO92] YPO0362 [Yersinia pestis CO92]  ali follow..  17  14.................................................................ANLLKRAAIMAEIRRFFADRGVLEVETPTMSQATVTDIHLVPFETRFVGPGAADGLTLYMMTSPEYHMKRLLAA---------PIYQLGRSFRNEEAGRYHNPEFTMLEWYRPHYDRLMNEVDDLLQQILDCNSAETLSYQQAFLRHLNIDPLSAEKAQLREVALFTVGVEPYIGRDKPAFIYHFPASQASLAEISTEDHRVAERFEVYFKGIEL.. 245
11 -29.100IDP90840 gene: pheS; phenylalanyl-tRNA synthetase subunit alpha [Shigella flexneri 2a str. 2457T] S1634 [Shigella flexneri 2a str. 2457T]  ali follow..  15  32....LGKKGHLTLQMTTLRELPPEERPAAGAVINEAKEQVQQALNARKAELESAALNARLAAIENGGLHPVTRTIDRIESFFGELGFTVATGPEIEDD--FDALNIPGHHPARADHDTFDATRLLRTQTSGVQIRTMKAQ----QPPIRIIAPGRVYRND-YDQTHTPMFHQMEGLIVDTNISFTNLKGTLHDFLRNFFEEDLQIRPSYFPFTEPSAEVDKWLEVLGCGMVHPNVLRNVSIDPE-FAFGMGMERLTMLRYGVTDLRSFENDLRFLKQFK... 327
12 -29.000IDP90756 gene: pheS; phenylalanyl-tRNA synthetase subunit alpha [Yersinia pestis CO92] YPO2429 [Yersinia pestis CO92]  ali follow..  14  29.VEYLGKKGHLTLQMTSLRELPAEERPAAGAVINQAKQEVQEALNARKEKLESAVLNARLAAETIDGLHPVTRTIERIETFFGELGFSVESGPEIEDD--FDALNIPAHHPARADHDTFDATRLLRTQTSGVQIRTMQEQ----QPPIRIIVPGRVYRND-YDQTHTPMFHQMEGLIVDRDISFTNLKGTLHDFLRNFFEEDLQIRPSYFPFTEPSAEVDKWLEVLGCGMVHPNVLRNVGIDPE-FAFGMGMERLTMLRYGVTDLRAFENDLRFLKQFK... 327
13 -28.800IDP90652 gene: pheS; phenylalanyl-tRNA synthetase subunit alpha [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0897c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  11  27.KKGILTE-----GFTKLKELEDEAKKEFAAKLNAQKEIFNEAYLAKFKDLENLALEERMKQITTGALHPVMSTMDKIIEYFIALNFSIEKGPLIEDD--FEALNLPKSHPARDMQDTFDDKRLLRTQTSPVQIRTMLAQ----KPPIRMIAPGAVFRRD-FDITHTPMFHQVEGLVVEEGQKVSFANLKSVLEFTEPSAEVDISCVFCKGKGCRVCKHTGWLEVLGCGIVDPNVYNFVGYENSGYAFGLGVERFAMLLHQIPDLRSLEGDLRLLEQFR... 330
14 -28.600IDP01693 gene: yjeA; lysyl-tRNA synthetase [Salmonella typhimurium LT2] STM4344 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  18  14.................................................................PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPFETRFVGPGHSQGINLYLMTSPEYHMKRLLAA---------PVFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDRLMNEVDDLLQQVLDCQPAESLSYQQAFQRHLEIDPLSADKTQLREAALFTMGVEPHIGKEKPTFIYHFPASQASLAQISTEDHRVAERFEVYYKGIEL.. 245
15 -28.100IDP06044 gene: pheS; phenylalanyl-tRNA synthetase subunit alpha [Helicobacter pylori J99] NP_223695 [Helicobacter pylori J99]  ali follow..  12  27.KKGVFADKFNQLKNLNGEEKNAKEIHHYKQAFEKAFELKKKAIMELELEERLKKEKIDV--IKTSSSHPLNYTKNKIIEFFTPLGYKLEIGSLVEDD--FSALNLPPYHPARDMQDTFKDHKLLRTHTSPVQIHTMQEQ----TPPIKMICLGETFRCD-YDLTHTPMFHQIEGLVVDQKGNIRFTHLKGVIEFTEPSAEVDISCVFCKQEGCRVCSHTGWLEVLGCGMVNNAVFEAIGYENSGFAFGMGIERLAMLTCQINDLRSFETDLRVLESF.... 328
16 -27.600IDP90685 gene: lysS; lysyl-tRNA synthetase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0401 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  15  103..KKNLEVGDIVLVKGFPFVTKTGEFSLHASEVKLATKEKYHGLTDIEQRYRKRYVDMIMNVEVRKDFLVRSKVVSLIRHFFENKGFLEVETPMMHPI-----AGGANAKPFVTFHNSLGVERFLRIAPELYLKRLIVG---------AVFEINRCFRNEGMDLTHNPEFTTIEFYWAYHN--YKDLMDLTEELFALLLINFSKPFERITYKDALCKYGGLDRDLIEDKEKILTKLKADGFENPTFVIDFPISISPLSRRSDEDSQIAERFELFICGREL.. 412
17 -27.200IDP02443 gene: lysS; lysyl-tRNA synthetase [Listeria monocytogenes EGD-e] lmo0228 [Listeria monocytogenes EGD-e]  ali follow..  16  108...KLADLGDIIGIKGTIFRTNTGELSVKATEFTLLSKDKYHGLKDVEQRYRQRYLDLITNEESQNRFVMRSKILKYTRDYMDNQGFLEVETPVLHTI-----AGGAAAKPFITHHNALDMELYLRIALELHLKRLIVG---------KVYEIGRVFRNEGTSTRHNPEFTMLESYAAYED--YEDVMDLVEGLVSTVCVDLTPNWRRIHMADAVKEYVGVDFWNVTSDEEARELAKKHDVPQPTFVYGHPVEISPLAKKNKEDERFTDRFELFIVGREH.. 416
18 -27.200IDP06319 gene: lysS; lysyl-tRNA synthetase [Streptococcus pneumoniae TIGR4] NP_345214 [Streptococcus pneumoniae TIGR4]  ali follow..  14  103...KKADLGDFLGVEGEVMRTDMGELSIKATHITHLSKEKFHGLTDVETIYRKRYLDLISNRESFERFVTRSKIISEIRRYLDQKGFLEVETPVLHNE-----AGGAAARPFITHHNAQNIDMVLRIATELHLKRLIVG---------RVYEIGRIFRNEGMDATHNPEFTSIEVYQAYAD--FQDIMDLTEGIIQHAAIKINEPFKRVHMVDAIREITGVDFWQDMTLEEAKAIAAEKKVPQPTFVYGHPVAVSPLAKKNPEDQRFTDRFELFIMTKEY.. 412
19 -27.100IDP90947 gene: lysS; lysyl-tRNA synthetase [Staphylococcus aureus subsp. aureus MRSA252] SAR0518 [Staphylococcus aureus subsp. aureus MRSA252]  ali follow..  15  106...KNADLGDIVGVEGVMFKTNTGELSVKAKKFTLLTKDKFHGLQDIEQRYRQRYLDLITNEDSTRTFINRSKIIQEMRNYLNNKGFLEVETPMMHQI-----AGGAAARPFVTHHNALDATLYMRIAIELHLKRLIVG---------KVYEIGRVFRNEGVSTRHNPEFTMIELYEAYAD--YHDIMDLTESMVRHIAIDLESAWTRLHIVDAVKEATGVDFYEVKSDEEAKALAKEHGIEQPTFIYGHPTEISPLAKKNPEDPRFTDRFELFIVGREH.. 414
20 -27.000IDP04576 lysyl-tRNA synthetase [Bacillus anthracis str. Sterne] BAS0076 [Bacillus anthracis str. Sterne]  ali follow..  15  108...KTADLGDLVGIEGKVFKTNVGELSVKATGFTLLTKDKYHGLKDVEQRYRQRYLDLITSMESRETFVTRSKIIREMRRYLDDNGYLEVETPMMHAI-----AGGASARPFITHHNALDMELYMRIAIELHLKRLIVG---------KVYEIGRVFRNEGVSTRHNPEFTMIELYEAYAD--YKDIMKLTENMVAHIAINLEPEWTRLHMVDAIKEHSGADFWNPMSVEEARELAKEHNVEQPTFIYGHPVEISPLAKKNDEDPRFTDRFELFIVAREH.. 416
21 -26.800IDP06134 gene: lysS; lysyl-tRNA synthetase [Helicobacter pylori J99] NP_222891 [Helicobacter pylori J99]  ali follow..  16  103...KHLEVGDIVLVKGFPFATKTGELSIHALEFHILSKEKFHGLSDIELRYRQRYLDLIVNPGVKDVFKKRSLIVSSVRKFFEMEGFLEVETPMMHPI-----PGGANARPFITYHNALEIERYLRIAPELYLKRLIVG---------AVFEINRNFRNEGMDHSHNPEFTMIEFYWAYHTDLIELSKRLFDYLLKTLNLDSKIIYNDMEVDFNQTSVIEQGIKVEPNLTHGKLLAEAFDLINPTFVTEYPIEISPLARRNDSNPNIADRFELFIAGKEI.. 410
22 -26.400IDP90637 gene: lysS; lysyl-tRNA synthetase [Yersinia pestis CO92] YPO0888 [Yersinia pestis CO92]  ali follow..  13  113..FKKWDLGDILGARGKLFKTKTGELSIHCSELRLLTKDKFHGLADQETRYRQRYLDLIANDESRHTFKVRSQVMSGIRSFMVEKGFMEVETPMMQVI-----PGGASARPFVTHHNALDIDMYLRIAPELYLKRLVVG---------RVFEINRNFRNEGVSPRHNPEFTMMELYMAYAD--YKDLIVLTEELFRTLPETNVADLDDMDKAVAIAESLG--IKVEKSWGLGRIQCEIFELIQPTFITEYPAEVSPLARRNDDNPFITDRFEFFIGGREI.. 423
23 -26.000IDP90889 gene: lysS; lysyl-tRNA synthetase [Vibrio cholerae O1 biovar eltor str. N16961] VC0664 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  14  115...QGLDIGDIIGVQGALHKSGKGDLYVNMEQFQLLTKEKFHGLTDQEMRYRQRYVDLIVNENSRNAFIVRSKVMSAIRNFMISKQFMEVETPMMHVI-----PGGASARPFITHHNALDMPMYLRIAPELYLKRLVVG---------RVFEINRNFRNEGLSPRHNPEFTMMEFYMAYAD--YKDLMDLTEELLSSVPNHAQIQALTEEDIQNRDLMVSIAKSVHVDVEPFWTCGQEPKLMQPTFITGYPADISPLARRSDDNPFFTDRFEFFIGGREV.. 430
24 -22.800IDP05234 gene: aspS; aspartyl-tRNA synthetase [Listeria monocytogenes EGD-e] lmo1519 [Listeria monocytogenes EGD-e]  ali follow..  17  75..KGTVHARGEKAINEKLATGKVEVLATILNTSKTPPFYIEDGVNVSDELRLKYRYLDLRRPEMNNIFKMRHTVTRTFRNKLDALGFFDIETPYL-----TKSTPEGARDYLVPSRVYPGNFYALP--QSPQILKQLL----MTAGFDKYYQIVRCFRDEDLRGDRQPEFTQIDLETSFLT--KEEIQAITEDMLVDV.................................................................................... 260
25 -22.700IDP90630 gene: aspS; aspartyl-tRNA synthetase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0640c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  18  73..EGTIRPRGEGLVNPKLKTGEIEVVVSKLTIENESAVPPFAIADESVNEELRLKYRFLDLRNPKENFALRSKACIAARNSLANMGFLEVETPIL-----TKATPEGARDYLVPSRVHQGEFYALP--QSPQLFKQLL----MCSGFDRYFQIAKCFRDEDLRADRQPEFTQIDVEMCEQKDVIKVAETFLKDIFKACGKE................................................................................. 264
26 -21.900IDP05303 gene: aspS; aspartyl-tRNA synthetase [Staphylococcus aureus subsp. aureus COL] SACOL1685 [Staphylococcus aureus subsp. aureus COL]  ali follow..  17  75..QGTVTKRDPETVNPKIKEVQVTNIKVINKSETPPFSINEENVNVDENIRLKYRYLDLRRQELAQTFKMRHQITRSIRQYLDDEGFFDIETPVL-----TKSTPEGARDYLVPSRVHDGEFYALP--QSPQLFKQLL----MISGFDKYYQIVKCFRDEDLRADRQPEFTQVDIEMSFVD--QEDVMQMGEEMLKKV.................................................................................... 261
27 -21.200IDP90838 gene: aspS; aspartyl-tRNA synthetase [Yersinia pestis CO92] YPO2053 [Yersinia pestis CO92]  ali follow..  19  72..TGTVRARPDSQIN---KDMSTGEVEIFANTLNIINRSEPLPLDSNQINSEEQRLKDLRRPEMADRLKSRAKITSFVRRFMDDHGFLDIETPML-----TKATPEGARDYLVPSRVHKGKFYALP--QSPQLFKQLL----MMSGFDRYYQIVKCFRDEDLRADRQPEFTQIDVETSFMS--ADQVREVMEKLVREL.................................................................................... 255
28 -21.000IDP04615 aspartyl-tRNA synthetase [Bacillus anthracis str. Sterne] BAS4297 [Bacillus anthracis str. Sterne]  ali follow..  17  75..EGTVVERGEGAINDNM---ATGRIEVQATKVSVLNAAKTTPIIIADDTDASEDVRDLRRPVMFNTFKMRHDVTKTIRNFLDTEEFLEVETPIL-----TKSTPEGARDYLVPSRVHDGEFYALP--QSPQLFKQLL----MVGGFERYYQVARCFRDEDLRADRQPEFTQIDIEALTQDEILDMMERMMTKVMKDA.................................................................................... 264
29 -20.800IDP90878 gene: aspS; aspartyl-tRNA synthetase [Vibrio cholerae O1 biovar eltor str. N16961] VC1166 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  18  72..TGEVRARPESQVNKEM---ATGEVELLARSLEIINRSDVLPLDFNQKNSEEQRLKDLRRPEMSDRIKLRAKASSFVRRFLDTHGFLDIETPVL-----TKATPEGARDYLVPSRVHKGSFYALP--QSPQLFKQLL----MMSGFDRYYQIVKCFRDEDLRADRQPEFTQIDIETSFMTA--EQVRAVTEKMIREM.................................................................................... 255
30 -20.000IDP06242 prolyl-tRNA synthetase [Streptococcus pneumoniae TIGR4] NP_344802 [Streptococcus pneumoniae TIGR4]  ali follow..  17  1...............MKQSKMPIPTLREMPSDAQVISHA-------LRAGYVRQVSAGVYSYLPLANR-VIEKAKNIMRQEFEKIGAVEMLAPALLSAELWRESGETYGEDLYKLKNREKSDFILGPTHEETFTAIVRDSVKSYKQPLNLYQIQPKYRDEKRPRNRTREFIMKDAYSFHANYDSLDYKAAYERIFTRSGLDFKAIIGDGGAMGG.................................................................... 204
31 -19.800IDP05230 gene: proS; prolyl-tRNA synthetase [Listeria monocytogenes EGD-e] lmo1319 [Listeria monocytogenes EGD-e]  ali follow..  17  1...............MRQTMTFIPTLKEVPADAEVKSHQ-------LRAGFIRQTASGIYSYLPLATL-MLRKIETIIREELEAIGAAELLMPALQPAELWQESGNDYGPELMRLKDRASRDFALGPTHEEVITALLRDEVKSYKRPLTLYQIQTKFRDEKRPRFRGREFIMKDAYSFHATEVYNLMHQAYSNIFTRCGLEFRSVIADSGSIGGNESK................................................................ 208
32 -19.700IDP90551 prolyl-tRNA synthetase [Vibrio cholerae O1 biovar eltor str. N16961] VC0875 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  16  1...............MRTSNYLLSTLKETPNDAEVVSHK-------LRAGMIRKLASGLYTWLPTGLR-VLRKVENIVRQEIDNAGAIETLMPVVQPFELWEETGEKMGPELLRFTDRHERPFVLSPTAEEVITALVRNEVSSYKQPLNLYQIQTKFRDERPRFGRAREFCMMDAYSFDIDKSYEAMHVAYCKAFDRMGLDYRPVLADTGAIGGNGSH................................................................ 208
33 -19.700IDP05337 gene: proS; prolyl-tRNA synthetase [Staphylococcus aureus subsp. aureus COL] SACOL1282 [Staphylococcus aureus subsp. aureus COL]  ali follow..  16  1...............MKQSKVFIPTMRDVPSEAEAQSHR-------LKSGLIKQSTSGIYSYLPLATR-VLNNITAIVRQEMERIDSVEILMPALQQAELWEESGGAYGPELMRLQDRHGRQFALGPTHEELVTSIVRNELKSYKQPMTLFQIQSKFRDEKRPRFRGREFIMKDAYSFHADQTYQDMYQAYSRIFERVGINARPVVADSGAIGGSHTH................................................................ 208
34 -19.600IDP90927 gene: proS; prolyl-tRNA synthetase [Yersinia pestis CO92] YPO1068 [Yersinia pestis CO92]  ali follow..  15  1...............MRTSQYLLSTQKETPADAEVISHQ-------LRAGMIRKLASGLYTWLPTGVR-VLKKVENIVREEMNNAGAIEVSMPVVQPADLWQESGEQYGPELLRFVDRGERPFVLGPTHEEVITDLIRGEINSYKQPLNFFQIQTKFRDEVRPRFRAREFLMKDAYSFHTTETYDAMYTAYSKIFSRMDLNFRAVLADTGSIGGSASH................................................................ 208
35 -19.500IDP04603 prolyl-tRNA synthetase [Bacillus anthracis str. Sterne] BAS3670 [Bacillus anthracis str. Sterne]  ali follow..  14  1...............MKQSMVFSPTLREVPADAEIKSHQ-------LRAGFMRQNASGIYSFLPFGLK-VLHKVERIVREEMERAGAVELLMPAMQAAELWQESGYSYGSELMRMKDRNAREFALGATHEEVITDLVRDEVKSYKKPLTLYQIQTKFRDEQRPRFRGREFLMKDAYSFHATEVYDRLYKAYSNIFARCGLNFRAVIADSGAMGGKDTH................................................................ 208
36 -19.300IDP90581 gene: proS; prolyl-tRNA synthetase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0543 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  15  2...............MRFTKFYAPSLKEAPKDASLPSHI-------TRAGFVEQIGSGLYNFLPLGKR-VLDKIKNIVKEEMDKAGAQEVNLSFITPASLWQESGNVFGKELLRFKDRKENEFVLGPTHEEAMLSLVKNKITSYKQPLHLYQIGLKFRDEARPRFRCREFLMKDGYSFHANREFELMYKTYSQILQRMGLDFRAVEADSGAIGGSGSK................................................................ 209
37 -19.300IDP05650 gene: proS; hypothetical protein Cj0539 [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0543 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  15  2...............MRFTKFYAPSLKEAPKDASLPSHI-------TRAGFVEQIGSGLYNFLPLGKR-VLDKIKNIVKEEMDKAGAQEVNLSFITPASLWQESGNVFGKELLRFKDRKENEFVLGPTHEEAMLSLVKNKITSYKQPLHLYQIGLKFRDEARPRFRCREFLMKDGYSFHANREFELMYKTYSQILQRMGLDFRAVEADSGAIGGSGSK................................................................ 209
38 -19.200IDP90728 gene: asnC; asparaginyl-tRNA synthetase [Yersinia pestis CO92] YPO1412 [Yersinia pestis CO92]  ali follow..  14  77..TGTVVASPGEGQSFEIQATAINVVGWVDDPDTYPMAAKRHSIEYLREVAHLR----PRTNLIGAVARVRHTLAQAIHRFFDENGYFWVSTPLITASD-LENLPRTDTGAVDFSEDFFGKEAFLTVSGQLNGETYACALS-------KVYTFGPTFRAENSNSRHLAEFWMVEPEVAFAS--LDDVAGLAEKMLKYV.................................................................................... 273
39 -19.200IDP90531 RecName: Full=Asparaginyl-tRNA synthetase; AltName: Full=Asparagine--tRNA ligase; Short=AsnRS Q9KSF9 [Vibrio cholerae]  ali follow..  14  77..TGKIVESPASGQAFELAASDVKVVGWVEDADTYPMAKTRHSIEYLREVAHLR----PRTNVIGAVARVRNCLAQAIHRFYHEQGYFWVSAPLITASDDMENLPRTDAGKVDYNQDFFGKETFLTVSGQLNAEAYACAIS-------KVYTFGPTFRAENSNSRHLAEFWMVEPEVAFAD--LNTVAKLAEDMLKYV.................................................................................... 273
40 -18.800IDP05569 asparaginyl-tRNA synthetase [Bacillus anthracis str. Sterne] BAS4454 [Bacillus anthracis str. Sterne]  ali follow..  14  76..EGKVIATPGAKQPFEIKAEKIDIEGLSDSDYPLQKKRHTFEYLRTIAHLRPRTNA-------SATFRVRSIAAFAIHQFFQERGFVHVHTPIITGSDDLNNVPKGEDGQVDESKDFFGKETNLTVSGQLNAEAYALAFR-------DVYTFGPTFRAENSNTTHAAEFWMVEPEIAFAE--LGDVMNLTEDMLKYA.................................................................................... 270
41 -18.500IDP05239 gene: ansB; asparaginyl-tRNA synthetase [Listeria monocytogenes EGD-e] lmo1896 [Listeria monocytogenes EGD-e]  ali follow..  16  63.....LTQETSLYVTGTIDTRSPFGYEMAVSSVEVISESHDYPITPKEHGTEFLMDHRHLWLRSNRQHKIRNEIIRASYEFFNKEGFLKIDPPILTGSA-----PEGTTELFHTKYFEEDAFLSQSGQLYMEAAAMAFG---------KVFSFGPTFRAEKSKRRHLIEFWMIEPEMAFYK--LEDSLQVQENYVAFL.................................................................................... 245
42 -18.300IDP05333 aspartyl-tRNA synthetase [Bacillus anthracis str. Sterne] BAS2031 [Bacillus anthracis str. Sterne]  ali follow..  16  70..IGEIVETSKTELGVEV---LAHEVKILNGAEPLPFEINKKKLQVGLDQLLNERVLSLRHERTTAIFKVKSTLVQSFSELLIENDFTRIFTPKIVSQG------AEGGANVFK-LPYFQKEAYLAQSPQFYKQMMVAGGLE------RVFEIAPVYRAEHHNSRHLNEYISLDVELGFIHD-FHEVMQLETDVLRYM.................................................................................... 249
43 -18.200IDP05209 gene: asnC; asparaginyl-tRNA synthetase [Staphylococcus aureus subsp. aureus COL] SACOL1494 [Staphylococcus aureus subsp. aureus COL]  ali follow..  16  63.....ITQESSLYVTGTITEDNRSDYEMQVKSIEVISEAHDYPITPKNHGTEFLMDHRHLWLRSKKQHKIRNEVIRATYEFFNKDGFTKVDPPILTASA-----PEGTSELFHTKYFDQDAFLSQSGQLYLEAAAMAHG---------KVFSFGPTFRAEKSKRRHLIEFWMIEGEMAFTN--HAESLEIQEQYVTHV.................................................................................... 245
44 -17.500IDP05140 prolyl-tRNA synthetase [Bacillus anthracis str. Sterne] BAS0382 [Bacillus anthracis str. Sterne]  ali follow..  2......................AKEQVQAITKMEEDFAQWYTDIVKKAELVDYSSVKGCMILRPYGYA-LWENMQKVMDEKLKATGHENVYMPMFIPESLLQKEKDHVEGVTHGGDEKLAERLCVRPTSETLFCEHFSKIVQSYNDPKLYNQWCSVVRWEKTTRPRTTEFLWQEGHTI-TAEESQAETLNILNLYASFCEDYLAI............................................................................. 194
45 -14.700IDP05712 threonyl-tRNA synthetase [Bacillus anthracis str. Sterne] BAS4472 [Bacillus anthracis str. Sterne]  ali follow..  14  214......SNNKMLQRIYGTAFVKKAELDEHLRMLEEAKERDHRKLGKELKLFTNSQKVG---LWLPKGATIRRIIERYIVDKEASLGYDHVYTPVLGSRELYETSGNHYRDGMFPSMEMDNEELVLRPMNCPHHMMVYKNDIHSYREPIRIAELGTMHRYEMSGAQRVRGMTLNDAHIYADDEMWEKAQGMLKEAMDEMGLDYYEAEGEAAFYGPKLDVQVRTALGKDETLSTVQLDFLLPERFELSYVGEDGKQHRPVVIHRGVVSTMERFVAFL....... 535
46 -14.700IDP05335 threonyl-tRNA synthetase [Bacillus anthracis str. Sterne] BAS2222 [Bacillus anthracis str. Sterne]  ali follow..  16  213......SNNQVLQRIYGVAFSSQKELEEYLHFVEEAAKRNHRKLGNELELFMFSEEAPGMPFYLPKGQIIRNELEAFLREIQKEYNYQEVRTPFMMNQEVWERSG-GHYKDNMYFSEVDNKSFALKPMNCPGHMLMFKNKLHSYREPIRMCEFGQVHRHEFSGALRVRTFCQDDAHLMGDDELWEQAEASLENVLQSLNYKYRLNEGDGAFYGPKIDFHIKDALNRSHQCGTIQLDFQMPEKFDLNYIDEKNEKRRPVVIHRAVLGSLDRFLAIL....... 527
47 -14.600IDP90813 threonyl-tRNA synthetase [Vibrio cholerae O1 biovar eltor str. N16961] VCA0287 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  17  211......SDNKMLQRIYGTAFHDKKALQAHLTRLEEAAKRDHRKIGKQLDLFHMQQEAPGMVFWHHNGWSIFRDLEIFIRQKLNEYGYQEVKGPLMMDRVLWERSG-DKYADAMFTTSSENREYAIKPMNCPGHIQIFNQGLKSYRDPLRMAEFGSCHRNEPSGS-RVRGFTQDDAHIVGSDEIWDKSEQALIDSLKAMDIPFEIQEGEGAFYGPKIEFTLYDCLDRAWQCGTVQLDFNLPTRLGATYVGESNERLIPVMIHRAILGSLERFIGIL....... 526
48 -14.400IDP05080 gene: thrS; threonyl-tRNA synthetase [Listeria monocytogenes EGD-e] lmo1559 [Listeria monocytogenes EGD-e]  ali follow..  13  208......SNNKMLQRIYGTAFFDKNGLKEFIQMQKEAKERDHRKLGKELELFTNSIEVG---LWLPKGATIRRVIERYIVDKEERLGYNHVYTPIMANVELYKTSGDHYHEDMFPTMKMDNEELVLRPMNCPHHMMIYKNDIHSYREPIRIAELGMMHRYEMSGA-RVRGMTLNDAHVFDDDAMWEKAQAMLKSAMDEMEMDYFEAEGEAAFYGPKLDVQVKTAIGKEETLSTVQLDFLLPERFDLTYIGEDGEKHRPVVIHRGVVSTMERFVAYL....... 529
49 -14.300IDP90770 gene: thrS; threonyl-tRNA synthetase [Yersinia pestis CO92] YPO2433 [Yersinia pestis CO92]  ali follow..  15  210......SKNKMLQRIYGTAWGDKKQLNAYLQRLEEAAKRDHRKIGKQLDLYHMQEEAPGMVFWHNDGWTIFRELETFVRMKLKEYQYQEVKGPFMMDRVLWEKTG-ENYAEHMFTTSSENREYCIKPMNCPGHVQIFNQGLKSYRDPLRMAEFGSCHRNEPSGAMRVRGFTQDDAHVIGSDELWTRAEDDLAAALTENGIPFDYQPGEGAFYGPKIEFTLHDCLDRAWQCGTVQLDFSLPGRLSASYIGENNDRQVPVMIHRAILGSMERFIGIL....... 525
50 -14.100IDP90668 gene: thrS; threonyl-tRNA synthetase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0206 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  15  175......EKREMLTRIYGTAFADKESLKEYLTIIEEAKKRDHRKLGTELKLFTFDDEIG---IWLSNGARLRSKLEHMLYKIHRLRGYEPVRGPELLKADAWKISG-ANYKENMYFTQIDEQEYGIKPMNCVGHIKIYQSDVRSYRDPLKFFEYGVVHRHEKSGVFRVREFTQDDAHIIGDDEIWEIATKALKEALDEQGLKYGIDEGGGAFYGPKIDIKITDALKRKWQCGTIQVDFNLPSRFKLEYTDSDNEKKQPVMLHRAILGSFERFIGIL....... 490
51 -13.700IDP06315 gene: thrS; threonyl-tRNA synthetase [Streptococcus pneumoniae TIGR4] NP_346071 [Streptococcus pneumoniae TIGR4]  ali follow..  16  209......SDNAMMQRIYGTAWFDKKDLKNYLQMREEAKERDHRKLGKELDLFMISQEVG---FWLPNGATIRRELERYIVNKELVSGYQHVYTPPLASVELYKTSG--QEDMFPTMDMGDGEEFVLRPMNCPHHIQVFKHHVHSYREPIRIAEIGMMHRYEKSGAQRVREMSLNDGHLFDNDEMWENAQTMLRAALDEMGVDYFEAEGEAAFYGPKLDIQIKTALGKEETLSTIQLDFLLPERFDLKYIGADGEDHRPVMIHRGVISTMERFTAIL....... 531
52 -13.600IDP92033 prolyl-tRNA synthetase, putative [Toxoplasma gondii ME49] TGME49_019850 [Toxoplasma gondii ME49]  ali follow..  12  205..................EAVTDSSMLGVTAKKDENFSEWYTQAIVRSEMIEYYDISGCYIMRPWA-FHIWEKVQRFFDDEIKKMGVENSYFPMFVSRHKLEKEKDGFSPEVAWVTHYGDSPLAIRPTSETIMYPAYAKWIRSHRDPLKLNQWCSVVRWEFKQPTRTREFLWQEGHTAHATELVLDILELYRRWYEECLAVPVIK............................................................................. 406
53 -13.500IDP06149 gene: serS; seryl-tRNA synthetase [Helicobacter pylori J99] NP_224091 [Helicobacter pylori J99]  ali follow..  18  166.............................................................VIRGFGAKIYRALIHLMLDFNEKNGFEIIYTPALVNEKMLFGTG-QLPKFKEDVFKIENENLYLIPTAEVTLTNLYNDTIISVENPIKMTAHTPCFRSEAGSAGRQHQFDKVELVAIESDAMQEHMLESASEILKALELPHRFV............................................................................. 320
54 -13.500IDP92018 threonyl-tRNA synthetase, putative [Toxoplasma gondii ME49] TGME49_100260 [Toxoplasma gondii ME49]  ali follow..  11  363......QHLDSLQRVYGVSFPDKKLLKDYLKLLEEAKKRDHRVLGQNLHLFFFDTNVS---FWLPDGAKVYNKLCMFMREEYRFRGFQEVISPNIFSCDLWKVSG-QNYKENMYLFDVEGKEWGLKPMNCPGHCIMFKHLAPSYRQPLRLADFGVLHRNELSGSTRVRRFQQDDAHIFCRLDQVKEALNFLFFVYDQFGFSFELFLST----------------------------RPKKALGERAVWDSAEAALKAALEETGRPWQLNPGDGAFYGPKIDI 621
55 -13.400IDP90689 gene: serS; seryl-tRNA synthetase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0389 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  18  161.............................................................VLKNEGALLSRALVNYMIDFNRSRGFEFVNVPFLVNGATMFGTG-QLPKFKEDMYKVDDEDLYLISTSEIPVTNLYSGEILASETPIKMTCYSACFRKEAGSAGRQHQFEKVELVSIQSDSVFNEMLECASDLLSSLGLAHRHL............................................................................. 315
56 -13.100IDP06304 seryl-tRNA synthetase [Streptococcus pneumoniae TIGR4] NP_344934 [Streptococcus pneumoniae TIGR4]  ali follow..  18  165.............................................................FYKGLGARLERAIYNFMLDEHGKEGYTEVITPYIVNHDSMFGTG-QYPKFKEDTFELSDTNFVLIPTAEVPLTNYYRDEILDGKDPIYFTAMSPSFRSEAGSAGRLHQFHKVEMVKFESYEELEKMTANAENILQKLNLPYRVV............................................................................. 319
57 -12.400IDP90923 gene: serS; seryl-tRNA synthetase [Salmonella typhimurium LT2] STM0963 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  18  164.............................................................VMKGQIARMHRALSQMLDLHTEQHGYSENYVPYLVNHDTLYGTGGDLFHTRPLEEEADSSNYALIPTAEVPLTNLVRDEIIDEDQPIKMTAHTPCFRSEAGSYGRMHQFDKVEMVQIDSMAALEEMTGHAEKVLQLLGLPYRKI............................................................................. 326
58 -12.400IDP90835 gene: serS; seryl-tRNA synthetase [Shigella flexneri 2a str. 2457T] S0893 [Shigella flexneri 2a str. 2457T]  ali follow..  19  164.............................................................VMKGQIARMHRALSQMLDLHTEQHGYSENYVPYLVNQDTLYGTGGDLFHTRPLEEEADTSNYALIPTAEVPLTNLVRGEIIDEDDPIKMTAHTPCFRSEAGSYGRMHQFDKVEMVQIDSMAALEEMTGHAEKVLQLLGLPYRKI............................................................................. 326
59 -12.200IDP05146 glycyl-tRNA synthetase [Bacillus anthracis str. Sterne] BAS4784 [Bacillus anthracis str. Sterne]  ali follow..  12  40LKNNVKKWKKFIQESPYNVGLDAAILPKTWIASGHVGNFNDPMIDCKKCKARHRADKLIEDALDAKGI-EMVVDGLTFDQMADLMKEHEVKCPDCGSEEFTEIRQ----KTFQGVTESSTNEIFLRPETAQGIFVNFKNVQRSMRKPFGIGQIGKSFRNEITPGNRTREFEQMELEFFCKPGEDLEWRETCKNWLLSLGMT................................................................................. 253
60 -12.200IDP90714 gene: serS; seryl-tRNA synthetase [Yersinia pestis CO92] YPO1379 [Yersinia pestis CO92]  ali follow..  19  164.............................................................VMKGQIARMHRALSQMLDLHTEKHGYLEAYVPYLVNHATLYGTGEDLFHTKPLAEESDNSNYALIPTAEVPLTNLVRDEILEEDSPLKLTAHTPCFRSEAGSYGRMHQFDKVEMVQIDSMAALEELTGHAEKVLQLLELPYRKV............................................................................. 326
61 -12.200IDP06155 gene: thrS; threonyl-tRNA synthetase [Helicobacter pylori J99] NP_222834 [Helicobacter pylori J99]  ali follow..  15  185......ENNEMLIRIYGIAFATKEGLKDYLFQIEEAKKRDHRKLVELGLFSFDDEIGAGLPLWLPKGARLRKRIEDLLSQALLLRGYEPVKGPEILKSDVWKISG-DNYKENMYFTTIDEQEYGIKPMNCVGHIKVYQSALHSYRDPLRFYEYGVVHRHEKSGV-RVREFTQDDAHIIGDDKVWEKATNALKEALKEHRIDYKIDEGGGAFYGPKIDIKITDALKRKWQCGTIQVDMNLPERFKLAFTNEYNHAEQPVMIHRAILGSFERFIAIL....... 500
62 -12.100IDP90871 seryl-tRNA synthetase [Vibrio cholerae O1 biovar eltor str. N16961] VC1110 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  17  166.............................................................VMKGQFARLHRAIAQMLDLHTDQHGYTELYVPYLVNAETLFGTG-HTEPLTEKASDEEPRRLSLIPTAEVPVTNLVRDTILDEAEPLKMTAHTPCFRSEAGSYGRMHQFDKVELVQIDSMAALEELTGHAEKVLQLLELPYRKV............................................................................. 331
63 -12.100IDP04574 seryl-tRNA synthetase [Bacillus anthracis str. Sterne] BAS0015 [Bacillus anthracis str. Sterne]  ali follow..  14  181............................................................................MLDLHTDEHGYEEVLPPYMVNRASMTGTG-QLPKFEEDAFRIESEDYFLIPTAEVPVTNMHRDEILNKEQPIRYAAFSSCFRSEAGSAGRQHQFNKVELVKFDSYEELEKLTNDAERVLQLLELPYRVM............................................................................. 320
64 -11.900IDP05331 gene: serS; seryl-tRNA synthetase [Staphylococcus aureus subsp. aureus COL] SACOL0009 [Staphylococcus aureus subsp. aureus COL]  ali follow..  17  181............................................................................MITKHTTQHGYTEMMVPQLVNADTMYGTGQLPKFEEDLFKVEKEGLYTIPTAEVPLTNFYRNEIIQPGVLPEKFTGQSACFRSEAGSAGRLHQFDKVEMVRFDSWNALEEMTTNAEAILEELGLPYRRV............................................................................. 320
65 -11.800IDP05251 gene: serS; seryl-tRNA synthetase [Listeria monocytogenes EGD-e] lmo2747 [Listeria monocytogenes EGD-e]  ali follow..  17  182.............................................................................MDLHSNEHGYEEMLPPYMVNRASMTGTG-QLPKFEEDAFLIEAEDYFLIPTAEVPVTNYHREDILKAEDPRKYTAFSACFRSEAGSAGRQHQFNKVELVQFDSYVALEKLTGNAEEVLRRLELPYRVL............................................................................. 320
66 -11.800IDP05339 gene: glyS; glycyl-tRNA synthetase [Staphylococcus aureus subsp. aureus COL] SACOL1622 [Staphylococcus aureus subsp. aureus COL]  ali follow..  11  41LKNNVKKWQKFITQSPFNVGIDAAILMKVWEASGHLNNFNDPMIDNKDSKIRYRADKLIEDYMQDVKGDENFIADGLFEQMKKIIDDEGIVCPVSKTANWTEIRQ----KTFQGVTEDSTNEIFLRPETAQGIFVNYKNVQRSMRKPFGIGQIGKSFRNEITPGNRTREFEQMELEFFCKPGEEIEWKTFASDWLTSLNMS................................................................................. 256
67 -11.800IDP90870 gene: pheT; phenylalanyl-tRNA synthetase subunit beta [Vibrio cholerae O1 biovar eltor str. N16961] VC1220 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  11  492.......................................................................KLPLKRVRDLLVDRGYQEAITYSFVEPEQQKLVVPGVDALILPNPISAEMSA-MRLSLIQGLLNTVVHNQKRQQPRVRLFEYGLRFIPDAAAENGMRQEPMLAGVISGARGEEHDMKGDLEAVLELTAKGKAYSFAATKH-GQAAAIMVDGKAIGVIGTVHPELERKFGLNGRTIVFEIEWNAI--NTRVIPEAAAISKFPANRRDIALVV 714
68 -11.800IDP04350 gene: pheT; phenylalanyl-tRNA synthetase subunit beta [Salmonella typhimurium LT2] STM1338_1_795 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  13  492.......................................................................DLSLKRVKTMLNDKGYQEVITYSFVDPKVQQLIHPGAEALLLPNPISVEMSA-MRLSLWSGLLATVVYNQNRQQNRVRIFETGLRFVPDTQANLGIRQDLMLAGVICGNRYDEHDLKGDLEAVLDLTGKLGDIQFKAEMN-GQSAAIYLKDERIGFIGVVHPELERKLDLNGRTLVFELEWNKL--ADRIVPQAREISRFPANRRDIAVVV 714
69 -11.700IDP90809 gene: pheT; phenylalanyl-tRNA synthetase subunit beta [Shigella flexneri 2a str. 2457T] S1635 [Shigella flexneri 2a str. 2457T]  ali follow..  11  492.......................................................................DLSLKRVKTLLNDKGYQEVITYSFVDPKVQQMIHPGVEALLLASPISVEMSA-MRLSLWTGLLATVVYNQNRQQNRVRIFESGLRFVPDTQAPLGIRQDLMLAGVICGNRYEEHDLKGDLESVLDLTGKLNEVEFRAEAN-GQSAAIYLKGERIGFVGVVHPELERKLDLNGRTLVFELEWNKL--ADRVVPQAREISRFPANRRDIAVVV 714
70 -11.600IDP90932 gene: pheT; phenylalanyl-tRNA synthetase subunit beta [Yersinia pestis CO92] YPO2428 [Yersinia pestis CO92]  ali follow..  12  492.......................................................................SLSLKRVKTALVDRGYQEAITYSFVDPKVQALLHPQQEALILPNPISVDMSA-MRLSLLTGLLSAVVYNQNRQQSRLRLFESGLRFVPDNTADLGIRQDVMLAGVIAGHRYDEHDLKGDLEAILELTGKLSDVQFRAEAH-GQSAAIYLAGEHIGFIGVVHPELERKLDLNGRTVVFEVQWNKL--ADRAVPQAREISRFPANRRDIAVVV 714
71 -11.400IDP05709 gene: pheT; phenylalanyl-tRNA synthetase, beta subunit [Staphylococcus aureus subsp. aureus COL] SACOL1149 [Staphylococcus aureus subsp. aureus COL]  ali follow..  12  491..............................................................VTSGQLTDRQYKTRMVKEVLEGAGLDQAITYSLVSKEDATAFSMQQRQTIDLLMPMSEAHASLRQSLLPHLIEAASYNVARKNKDVKLFEIGNVFFANGEGE---DQVEYLSGILTGDYVVNQLAKGVVDRVSEKLNLEFSYRRADIDGLGRTAEILLENKVVGFIGELHPILAADNDLK-RTYVFELNFDALMAVSVGYINYQPIPRFPGMSRDIALEV 721
72 -10.900IDP05679 gene: pheT; phenylalanyl-tRNA synthetase beta subunit [Listeria monocytogenes EGD-e] lmo1222 [Listeria monocytogenes EGD-e]  ali follow..  12  499.......................................................................QKARRVMRAYLEGAGLNQALTYSLTSKKDATRLALSDEKTVALSMPMSEEHSHLRTSIVPQLIRSASYNIARKNMDVALYEMGTVFYATEGDN---IEQEHLAGLITGNWHIADVLKGIVEGLVNKLGIKSELHWKQTEK-GRTASLVLEGQEIGYLGALHPAVEANYDLK-ETYVFEINVAALLDATKEKVVYHPIPRYPEMTRDLALLV 722
73 -9.800IDP06256 gene: glyQ; glycyl-tRNA synthetase subunit alpha [Streptococcus pneumoniae TIGR4] NP_345929 [Streptococcus pneumoniae TIGR4]  ali follow..  12  2.................................................................SKKLTFQEIILTLQQFWNDQDCMLMQAYDNE--------------------------------KGAGTMSPYTFLRAIGPEPWNAAYVEPSRRADGRYGENPNRLYQHHQFQVVMKPSPSNIQELYLESLEKLGIEDNWENPSTGSAGLGWEVWLDGMEITQFTYF--QQVGGLATGPVTAEVTYGLERLASYIQEVDSVYDI.............. 181
74 -9.500IDP04383 phenylalanyl-tRNA synthetase subunit beta [Bacillus anthracis str. Sterne] BAS4455 [Bacillus anthracis str. Sterne]  ali follow..  12  500.......................................................................QTKRRKVRRFLEGAGLYEAITYSLTSADKAKQYMPNEKAPVNLALPMSEERSQLRLSLVPQLLEAVSYNVARKNDSVALYEVGSIFLPTEAGE---KEEQHLAGVMTGLALHHAVVKGVLEGLFDVLGVSNQITYAPAKR-GRTADIVLDGEVIGFIGQLHPEAEKQLDVK-NTFVFELSLVKVFGTDAEETYYSAIPRFPSMTRDMAVVV 725
75 -9.060IDP90629 gene: pheT; phenylalanyl-tRNA synthetase subunit beta [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0896c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  13  485.......................................................................YIEFLNLRKRAVASGYFESLHYVLDNGEELKRLGFDSVKLKLINPITAELNT-LRTTLLNHLLNAASLNAKNSKKIIKLFELGAVFNVNN------QELNRIAFIHSGLKEEAKDFLLDIKNIIGDFKLKSS--KYNILSPYEQADIYLSDIKVGFIGRLHLKIENERDLP-KTYICELDLDLIRQDFKIAKPYSKFPAITRDLS...... 692

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 7 6 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Clustering of highly homologous sequences to reduce the size of large protein databases. Bioinformatics. 2001 Mar;17(3):282-3.