current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 5VMA Entity 1(prereleased), from PDB1018

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610    .  620    .  630    .  640    .  650    .  660    .  670    .  680    .  690    .  700
# Score Template Links and tools%idFirst MSNKERFLTLYHQIKSDANGYFSPEGIPYHSIETLICEAPDYGHMTTSEAYSYWLWLEVLYGHYTRDWSKLEAAWDNMEKYIIPVNEDGNDEQPHMSAYNPSSPATYASEKPYPDQYPSQLSGARPAGQDPIDGELKSTYGTNETYLMHWLLDVDNWYKYGNLLNPSHKAAYVNTFQRGQQESVWEAIPHPSQDDKSFGKPNEGFMSLFTKENQVPAAQWRYTNATDADARAIQAIYWAKELGYNNSTYLDKAKKMGDFLRYGMYDKYFQTIGSGKQGNPYPGNGKGACHYLMAWYTSWGGGLGDYANWSWRIGASHCHQGYQNPVAAYALSSDKGGLKPSSATGASDWEKTLKRQLEFYVWLQSKEGAIAGGATNSWNGDYSAYPAGRSTFYDMAYEDAPVYHDPPSNNWFGMQAWPMERVAELYYIFVKDGDKTSENVQMAKSCITKWVNYALDYIFIGSRPVSDEEGYFLDDQGRRILGGTNATVATTSAPGEFWLPGNIAWSGQPDTWNGFQSATGNPNLTAVTKDPTQDTGVLGSLVKAFTFFAAATKLETGNYTALGVRAKDAAAQLLEVAWNYNDGVGIVTEEEREDYDRFFKKEVYFPNGWNGTFGQGNQIPGSSTIPSDPQRGGNGVYTSFADLRPNIKQDPAWSSLESKYQSSFNEATGKWENGAPVFTYHRFWSQVDMATAYAEYHRLINLELast
1 -7.370CPX_91688_91668 Complex of B1AP14_HUMAN with Q914E0_9ENTO [Undefined organism]  ali follow..  15  770IKVNLQSMDAYHIEVNTGNAFQMQPGLESVFKRTLMGEILNYAHWSGSIKLTFTFCGSAM-GKLLLAYSPTHMIWDI--VLCIPWISQTHYRLVQQDEYTSAGNVTYQTGIVVPPGTPNKCDFSVRMLRDPFIGQTALLQGDTETAIDNAIARVADTVASG--PSNSTSIPALTAVETGHTSQVEPSDTMQTRHVKNYHSRSESTVENFLSRSACVYIEEYYTKDQDNVNRYMSWTINARRMVQ-----LRRKFELFTYMRFDM-EITFVITSRQLPGTSIAQDMPPLTHQIM--YIPPGGPVPNSTDFAWQTST--------NPSIFWTEGNAPPRMSIPFISIGNAYSNFYDGWSHF-----SQNGVYGYNALNNMGKLYARH-VNKDTPYQMSSTIR-VYFKPKH-----IRVWVPRPPRLSPYIKSSNVNFNPTNLTDERSSITYVPDTIRPDVRTNGAFGQQSGAVYV---------------------GSYRVVNR----ATHNDWQNCVWEDYNRDLLVTTTAHGCDI-IARCRCTTGVYFCQSRNKHYPVS----------------------EGPGLVEVQESEYYPKRYQSHVLLAAGFSEPGDCGGILRCEHGVVGIVTMGGEGV-VGFADIRDWLEDDAMEQGIKDYVEQLGNAFGSGFTNQI............................ 1413
2 -7.240IDP06250 gene: ileS; isoleucyl-tRNA synthetase [Streptococcus pneumoniae TIGR4] NP_346098 [Streptococcus pneumoniae TIGR4]  ali follow..  10  35........KLYQRRQELNQGFTLHDGPPYAN-------NIHVGHAMNKISKDIIVRSKSMSGFYA----PFIPGWDTHGLPIEQVLSKQGVKRKEMDLVEYLKLCREYALSQVDKQREDFKRLGVSGDWENPYVTLTPDYEAAQIRVFGEMANKGYIY-------------------RGAKPVYWSWSSESALAEAEIEYHDLVSTSLYY--------ANKVKDGKGVLDTDTYIVVWTTTFTITASRGLTVGADI-DYVLVQPAGEARKFVVAAELLTSLSEKFGWADVQVLETY-----------------GQELNHIVTEHPWGDHVTTDSGTGIVHTAPGGEDDYNVGIANNLEVAVTV-DERGIMMKNAGPEFEGQFKVVPTVIEKLGNLLLAQEEISHSYP-------FDWRTKK----------------------PIIWRAVPQWFASVSKFRQEILDE-----IEKVKFHSEWGKVRLYNMIRDRGDWVISRQRAW-GVPEDGTAIMVAETIEHVAQLFEEYGSSIWWERDAKDLL--------PEGFTHPGSPNGEFKKETDIMD-VW----DSGSSWNEGSDQYRGWFNSSLITSVANHGVAPYKQILSQGFALDGKGEKKSLGNTIAPSDVEKQFGAE..................................................... 616
3 -6.460IDP90764 gene: ileS; isoleucyl-tRNA synthetase [Salmonella typhimurium LT2] STM0046 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  10  36........DLYGIIRAAKKGFILHDGPPYAN-------SIHIGHSVNKILKDIIVKSKGLSGFDS----PYVPGWDC--ELKVEQEFGKPGEKFTAAEFRAKCREYAATQVDGQRKDFIRL--GVLGDWSHPYLTMDFKTEANIIRALGRIIKNGHLH-------------------KGAKPVHWCVDCRSALAEAEVEYYDKTSPSIDVAFRAVDQDAVKAKFGLPGVSGPVSLVIWTTTWTLPANRAISLAPDF-DYALVQIDGQAV--LAKDLVESVMQRIGAAEYTILGTV------------------GAELELLRFTHPFGDHVTLDAGTGAVHTAPGGPDDYVIGQKYGLETANPVGP-DGTYLPGTYPTLDGVN-VFKANDIVIELLKEKGALLHVEKMQHSY---CCW-------------------RHKTPIIFRATPQWF------VSMDKEGLRQQSLKEIKGVQWIPDWGQARIESMVANRPDWCISRQRTW-GVP--------------MSLFVHKETQELLPIERTLAAMEEVAKRVEVDGIQALGEDADQYEKVPDTLD-VW----DSGSTYLEGSDQHRGWFMSSLMISVAMKGKAPYRQVLTHGFTVDGQGRKKSIGNTVSPQDVMNKLGAD..................................................... 625
4 -6.340CPX_00617_00812 complex of IDP00812 with IDP00617 [Undefined organism]  ali follow..  15  472..........................................GSKSFSETINY----ESYRTTIDRKTNHKSIGWGVEAHKIMPYGRDSYDPTYGNELFSSNAGQNFLPTHQMPNFNPEFISVLSHKQNDTKKSKIKVTYQREDRYTNQW----NRLHWVGNNYKNQNTVTFTSTYEVDWQNHTVKLITNPGVXMFK-ATLSVGLIAPLASPIQESRANTNIENIGDG-AEVIKRT--SKKWGVTQNVQFD--VKDKKYNKDALIVKMQGFINSRTSFSDVKGSGYELTKRMI-WPFQYNIGLDVGQTLGYNIGGNNGSFNYSKTI-SYTQKSYVSEVDKQNSKSVK-WGVKANEFVDRYLFVQSPNGP-TGSAREYFAPDNQLPPLVQSGFYATLFPRTGIYAERKHNAFVNRN-WKTHKVKGHNXMKMKKLVKSSVASSIALLLLSNTVDAAQHITPVSEKKVDDKITLYKTTATSDNDKLNISQILTFN-NSGYKKPNPKDYNYSQFYWGGKYNVSVSSESNDAVNSYGGDIGLSGGLNGSKSFSETINYKQESYRTTIDRKTNHKAHKIMNNGWG---------PYGRDSYDPTYGNELFL----GGRQSSSNAGQNFLPTHQMPLLARGNFNPEFISVLSHKQNDTKKSKIKVTYQREMDRYTNQWNTVTFTSTYEVDWQNHTVKL............ 1267
5 -6.300IDP05142 isoleucyl-tRNA synthetase [Bacillus anthracis str. Sterne] BAS2027 [Bacillus anthracis str. Sterne]  ali follow..  10  25........NIFEQSIQNREGFVFYEGPPTAN-------LPHVGHALGRTIKDVVARYKTMAGYKV----LRKAGWDTVELGVLGISGKHEIEEYGIEPFIKESVFTYEKQWREFTDMDDPYVTLENPYIESVWHILGTIHEKGLLYVSPYLSSHEVAQGYKTVKDLSATVKFKVKDSENEYFLGWTTTP--------WTLPANVALAV--------HPNMEYVKAKQEGHVYIVAKERVQDVLKENYEVLSVHK--GEELLNISYTAPFPRVIGADFVTADSGTGKDCDVDIVRYLAKEDEKYEHSYPHCWRCDSPLLYY----AGESWLIRTTAIKDTFLQNNDTVTWYPDHMKHGRFGKFLENMV---------DWN--------SRNRYWGTPL---NVWECERCD-----HQFAPKSIADLRKHSMKE-EKCGSTMNRTPEVIDVWFDSGSMPFAQYHYPFENKELFEEQFPADVIAEGIDQT--------SLLAVSALYTGKVP---LGHVLDEEGQKMSKSKGNALDPVDLVGKFADALRWALLVDSALWNAKRFSERTVLEAKSKFVDTLVNVYSFYVLYANLDEYNPNETYDVKRTKLDEWVLSRLHSTTKKVRTALDDYQFTNAAREIAALVEVSNWYVR----------------------------RSRNRFWESGMNAEKAAAYETLH... 741
6 -6.190IDP92046 isoleucine-tRNA synthetase, putative [Toxoplasma gondii ME49] TGME49_007640 [Toxoplasma gondii ME49]  ali follow..  11  33........NTFKRSVELSKGFTFYDGPPFAT-------LPHYGHILAGTIKDVVTRYAHQTGHYV----DRRFGWDCVEFEILGITSRHEIVEMGIDKYNDSIVMRYASEWRS--DFDNDYKTLDTRFMESVWWVFKQLFDKGLVYIMPFLSNFEANQNYKDVKDPSIVIAFSCVEENGGVPLAWTTTP--------WTLPSNLALCV------NPELTYIQIRNKETKKDWVLCESRLDWLLKQLKMDLAKDFEVGAALKGKKYQPLFDFFNKEPRKDENIVTFRGTAFRVVADAYV-----------SDDSGTGIVHCA--------------------PAFGEDDFRVCMEQGIIVQG---DDNGVMTAEVGPELSNLY-IKEADKVVKKLLKAADRLVVNADCVHAY---HCWRSDT--PLIYRAVPSWFVRVEHMRERLVEANEQTYWVPSFV------------------------KEKRFKNWLAEARDWCVSRNRFWGTPIPLWTSEDFS------QIVCIGSLEELHKYTDKRLTDIHRHFIDDITIPDPRGPSFPPLRRVPEVFD-CW----ESGSMIAEGLDQTRGWFYTLMVISTALFDRPPFQNLIVNGLVLAADGRKKRLKNYPDPTEVVHAHGAD..................................................... 648
7 -6.040IDP05578 gene: valS; valyl-tRNA synthetase [Staphylococcus aureus subsp. aureus COL] SACOL1710 [Staphylococcus aureus subsp. aureus COL]  ali follow..  11  6.KYDPREVEAGRYEEWVKNGYFKPSEDKSKETYTIVIPPPNLGHAWDTTLQDIITRMKRMQGY--------DTLY-------LPGMDH----------------AGIATQAKVEAKLNEQGITRYDLGREKFLEQAKEEYASFIRAQWAKLGLGLDYFTLDEGLSKAVKKVFVDLYNRGERIINWDPKARTALSD----------IEVIHEDVQGAFYHFKYPYADGEGFIEIATTRPETMLGDTAIVVNPNDERIGKTVILPIVGRELPILADEY-VDIDFGSGHDPNDFEIG-VMDENGKMNDKAGKYEGMDRFDCRKQLVKDLKEQDLVIKIEDHVHSVGHSERS-GAVVEPYLSTQWFVRMEDLAKRSLDNQKTDDRIDFYPQRFEHTFNQWMEN---------RDWISRQLWWGHQIPAWYIYVGEEAPTDIENWQQDEDVLDTWFSWPFSTLGWPDLESEDFKRYYPTNTGYDIIFFWVARMIFQGLEFTDRRPFNDVL-------HGLVRAEDGRKMSKSLGNGVDPMDVIDEYGADSLRYFLATGSSPGHDLRYSTEKVESVWNFINKIWNGARFSLMNIGEDFKVEDIDLSGNLSLADKWILTRLNETIATVTDLSDKYEFGEVGRALYNFI.............................................................. 638
8 -6.030IDP90911 gene: ileS; isoleucyl-tRNA synthetase [Yersinia pestis CO92] YPO0475 [Yersinia pestis CO92]  ali follow..  11  36........DLYGIIRAAKKGFILHDGPPYAN-------NIHIGHSVNKILKDIIVKSKGMAGYDS----PYIPGWDC--ELKVEQLIGKPGEKVSAAEFRTACRKYAAEQVEGQKKDFIRL--GVLGDWDHPYLTMDFKTEANIIRALSKIIDNGHLH-------------------KGAKPVHWCTDCGSSLAEAEVEYYDKTSQSIDVRFNAVDTATVAAKFGVSAVNGPISLVIWTTTWTLPANRAISLNAEY-LYQLVQVEGECL--LAADLVESVMKRAGITQWAVLGSC------------------GSDLELLRFTHPFGDHVTLDAGTGAVHTAPGGPDDFVIGQKYGLEVANPV-GPNGCYLAGTYPTLDGLF-VFKANDVVVELLREKGALLHVEKLLHSY---CCW-------------------RHKTPIIFRATPQWF------ISMDQKGLRKQSLQEIKGVQWIPDWGQARIETMVANRPDWCISRQRTW-GVPHKETEQLHPRSIELMEEVAKRVEQDGIQAWWDLDPAEILGADAADYVKVPDTLDVDSGSTHSSVVDVRPEFGGHSPDMYLEGSDQHRGWFMSSLMIATAMKGKAPYRQVLTHGFTVDGQGRKKSIGNTISPQDVMNKLGGD..................................................... 623
9 -6.010IDP92640 gene: phnO; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b4093 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  13  43.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................RDPNMRYHLALLGEVVGMIGLHLQFHLHHVNWIGEIQELVVMPQARGLNVGSKLLAWAEEEARQAGAEMTELSTNVKRHDAHRFYLREGYEQS........................................................................................... 136
10 -5.980IDP04368 isoleucyl-tRNA synthetase [Bacillus anthracis str. Sterne] BAS3746 [Bacillus anthracis str. Sterne]  ali follow..  35........NIYETVQEHTKGFVLHDGPPYAN-------DIHMGHALNKVLKDFIVRYKSMTGFCA----PYVPGWDTHGLPIEQALTNKGVKRKEMTVAEFRKLCAEYAYEQVERQREQFKRLGVRADWDNPYITLEPAYEAQQIKVFGDMAKKGYIY-------------------KGQKPVYWSPTSESALAEAEIEYQDKKSASIYV--------AFSVKDGKNVLEGDEKYIIWTTTWTLPANLGISVHPEL-EYAIVKVNDEKY--IASELFETVAKTLEWENAEVVKTV------------------GSELEYTVAKHPFGDHVTTDAGTGCVHTAPGGEDDFIVGKKYGLEVLCPVDD-KGVLTEEAP-GFEGLF-YDKANKPITEKLEEVGALLKLTFITHSY---HDWRTKK----------------------PIIFRATAQWFASIEAFRKELLEA-----VAETKWVPAWGETRLHNMVRDRGDWCISRQRAW-GVPENGDPIITDETINHVADLFREHGSNVWFEREAKDLL--------PEGFTHPGSPNGEFRKETDIMD-VW----DSGSSYLEGSDQYRGWFNSSLSTAVAVTGKAPYKGVLSHGFVLDGEGRKKSIGNIVVPKKIMDQLGGD..................................................... 614

FFAS is supported by the NIH grant R01-GM087218-01
1 3 1 8 8 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.