current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 5Z0B Entity 1(prereleased), from PDB1018

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .
# Score Template Links and tools%idFirst DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQXPFEDHVKLVNEVTEFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVDETYVPKEFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVEKCCKADDKETCFAEEGKKLVAASQAALGLLast
1 -8.880IDP06013 LCCL-related multimodular protein CCp1C [Toxoplasma gondii] ACJ45039 [Toxoplasma gondii]  ali follow..  14 1367............DLFGGQTRDGMVGFSAYNCGGVAFDSIQLSPYKMESIADEC-PSFRQIACAQD--------FCSE------------CCNLPRSEWAQC-------------------EKKCRRND-----------------------PLASLLASGMITRLSTCCKKGNM-AC------------------QKEACEL------------------------------------------CCISWSPA------GSLDQIGADLQDATEREQEEC------KFQCAKHFVPRENLE............................................................................................................................................................................................................................................................................................. 1568
2 -7.660IDP90280 oocyst wall protein COWP, putative [Toxoplasma gondii ME49] TGME49_004420 [Toxoplasma gondii ME49]  ali follow..  1.............................................MKLVFPAVCVVPPVPSCPPGF--SLEQRGCVRSRQVPPIMR---CAKKSVLAGNECVTTEFAPSIEVCPEGFIEKNRKCRRVVNAQPQLGCKPGFTLQN-----------------GGDCIRVTEDDIITRCPPKSKHTSKGCVTVEKLDVVPSCPRGYELKKNACIMTQNIEPVPSCPQGFAFESGACVRTGAVPPRVSCPRQDNGCVLFEKHDLEAFCRDKTTTQPALPHCPAGFSFQNGECVRVQEDIARLE-----GKGFTLHEDRCVKEVTVAAELQPGATLMKDKCAILTSEKPAVTCPDKFIMADGVCCPKRGTGGCVRSTTAKPALSCERGELKKGECSMIQTVPAETACILGGALTPDGCVFIDTAPLSHRCGANFKMDIKGQCATVETIDPEHICPPGFAPSGTKKATCERFLTSPAAIKCPAGFEPAGTKCMKTARIQAIAS-----PHGFVFHEGACIPYKAN................................................................. 494
3 -7.550IDP92590 microneme protein, putative [Toxoplasma gondii ME49] TGME49_060190 [Toxoplasma gondii ME49]  ali follow..  2....................................................................................VGVFQLCLLTCLLCLLKGSDAIQLRQHRNGLGVEQS---------------------------SEETDIVGGRISSLQAELDSYCHNRYKQLCDGGNKKARYGTGIQSQQTAEWRCYFAEVLKPSGRKVQCVDDCGNYFPTFHATAHNQILNFIKDGVEKHCSPFQMACQGVLADTVARKDTGTASQKAKAWRCCVDNCGGEIECPGGRSETSGELLSQHYTREKELQKVIESQSAPCHDACVATPI---PPICADTESLLQSTKRSRAQRFIDDACQKLFNCHCKKDKKARKDRGRAGSQNDAEWRCYSLEELDFQKTNPSCIDECGNELPSTHHITWTKLPSKIDEATQKFCT------------ERQRAANDYCASEFADSLARY-----AGDQTSQFRCIKKAAMR--------------DAEGQCADSCKGTETCGGGRSRLDGPLSVDDVLNAHEGISEAMKSASTEC........................... 468
4 -7.090IDP90129 myristylprotein [Monkeypox virus] MPXV_ZAI1979_005_084 [Monkeypox virus]  ali follow..  10  77............................................................................................................................................................................................................................................................................................................................................................LRQSYNGTAPNCCRTFNRTHYWKKDGKISDKESCWPDVHDTGKCDVCQGDTFDMNICHQWIGSAFNRSDRTVEGRQSLINLYNKMQTLCSK--DASVPIC--ELFLHHLRAHNTEDSKEMIDYILRQQSADFKQKYMRCSYPTRDKLEESLKYAEPRE----DPECSNANVNFLLTRNYNNLGLCN---NTSVNNLQ--MDKTSSLRLSCGLSNNRAKVVQHNIKHSFDLKLHLISL 327
5 -5.950IDP91039 gene: hdeB; HdeB protein [Shigella dysenteriae 1012] Sd1012_5151 [Shigella dysenteriae 1012]  ali follow..  28......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LAANESAKDMTCQEFNPKAMTPVAWWMLHEETVYKGGDTVTLNETDLTQIPKVIEYCK-KNPQKNLYTFKNQASNDLPN.... 108
6 -5.690IDP91694 gene: FBLN2; fibulin-2 isoform b precursor [Homo sapiens] NP_001989 [Homo sapiens]  ali follow..  600..................................................LPGCLLLPGELCQHLCINTVGSYHCACFPGFSLQDDGRTCPPQPEAPQEPALKSEFSQVASNTIPLPLPQPNTCKDNGPCK----------------------------------QVCSTVGGSAICSCFPG---------AIMADGVSCEDINECVTDLHTCSRGEHCVNTLGSFHCYKALTCEPGYALKDGECEDVDE--------------CAMGTHTCQPGFLCCQA----RQRCMDGFLQDPEGNCVDINECTSLSEGFSCINTVGSYTCQRNPLICHASDDGTKCVDVNECETGVHRCGEGQVCHNLPGSYRCD-DAFGRGCIDVNECWASPGRLCQHTCENTLGSYRCSCASGFLLAADGKRCEDVNECEAQRCS--QECANIYGSYQCYCRQGYQLAEDGHTCTDIDECAQGAGILCCLNVPGSYQCACPEQGYTMTANGRSCKDVDECALGTHNCSSFRCLRFECPPNYVQVSKTKCERTTCHDFLECQNSPARITHYQLNFQTGLLV.................. 1099
7 -5.500IDP91721 gene: MMRN2; multimerin-2 precursor [Homo sapiens] NP_079032 [Homo sapiens]  ali follow..  51DPVGRNWCPYPMS-KTEKF-QKVKVMYRMAHPVYQVKQ-----KVLTSLAWRCCPGYTGPNCEHHDSMAIPEPADPGDS--GHLAAVINEVEVQQEQQEHLLGDLQNDVHRVADSLPGLWKALPGNLTAAVMEANQTGHEFPDRSLEQVLLPHVDTFLQVHFSPIWR--SFNQSLHSLTQAIRNLSLDVEANRQAISRVQDSAVARADFQELGAKFEAKVQEN-TQRVGQLRQDVEDRLHAQHFTLHRSISELQADVDTKLKRLHKAQEAPGTNGSLVLATPGAGARPEPDSLQARLGQLQRNLSELHMTTARREEELQYTRATLTRHVDEIKELYSESDETFDQISKVERQVEELMEKSLIMEENKEEVERQLLELNLTLQHLQGGHADLIKYVKDCNCQKLYLDLDVI------REGQRDATRALEETQVSLDERRQLDGSSLQALQNAVDAVSLAVDAHKAEGERARAATSRL--QALDDEVGALKAAAAEARHEVRQLHSAFAALLEDALRHEAVLAALFGEEVLEEMSEQTPGPLPLSYEQIRVALQDAASGLQEQALGWDELAARVTALEQASEPPRP. 674
8 -5.400IDP01810 gene: ygiB; hypothetical protein STM3187 [Salmonella typhimurium LT2] STM3187 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  11  34........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LAGCEKSDETVSDDCSAANP----------------GKSAECTTAYNNALKEAERTAPKYATR--------------------EDCVAEFGEGQCQQAPAQAGMAPENQ.... 111
9 -5.220IDP92598 sortilin, putative [Toxoplasma gondii ME49] TGME49_090160 [Toxoplasma gondii ME49]  ali follow..  615.......................................................................................................................................................................................................................................................................................................................................................SAGVLFHLDFNALNQQQCKGIWAADSVSSDYETWSP-----------------------------------------------------------SDGRAGGERCILGKHITYTTSECFNGRDFDRPKVSKVCCTMEDYE---CEFGFTRAI--------------GSTQCAAAAAATATGLAQFADESDAAAAAACTSSSFFYTSAYRKVPGDVCEEKVAVPCPAHSPVSRGGKTVLLL.. 793
10 -5.010IDP91685 gene: COL1A2; collagen alpha-2(I) chain precursor [Homo sapiens] NP_000080 [Homo sapiens]  ali follow..  12 1188.................................................................................................................................................................................................................................................................................................................................................................MDAIKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYASQNITYHCKNS---------------IAYMDEETGNLKKAVILQGSNDVELVAEGNSRFT----------------YTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFFVDIG------PVCFK................ 1366

FFAS is supported by the NIH grant R01-GM087218-01
1 3 1 8 8 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.