current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 5Z4O Entity 1(prereleased), from PDB1018

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .
# Score Template Links and tools%idFirst GGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVDNAIDEALAGHCKEIIVTIHADNSVSVQDDGRGIPTGIHPEEGVSAAEVIMTVLHAGGKFDDNSYKVSGGLHGVGVSVVNALSQKLELVIQREGKIHRQIYEHGVPQAPLAVTGETEKTGTMVRFWPSLETFTNVTEFEYEILAKRLRELSFLNSGVSIRLRDKRDGKEDHFHYEGGLast
1 -84.600IDP90819 gene: gyrB; DNA gyrase subunit B [Yersinia pestis CO92] YPO4094 [Yersinia pestis CO92]  ali follow..  88  14KGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVDNAIDEALAGHCKEILVTIHADNSVSVQDDGRGIPTGMHDEEGVSAAEVIMTVLHAGGKFDDNSYKVSGGLHGVGVSVVNALSEKLELVIRREGKVHEQTYKMGVPQAPLKVVGETEQTGTTVRFWPSFQTFTNNTEFQYEILAKRLRELSFLNSGVSIKLKDKRNDKEDHFHYEGG 221
2 -82.800IDP90603 gene: gyrB; DNA gyrase subunit B [Vibrio cholerae O1 biovar eltor str. N16961] VC0015 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  80  14KGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVDNSIDEALAGYCKDIVVTIHEDNSVSVSDDGRGIPTEMHPEEKVSAAEVIMTVLHAGGKFDDNSYKVSGGLHGVGVSVVNALSEKVLLTIYRGGKIHSQTYHHGVPQAPLAVVGETERTGTTVRFWPSAQTFTNI-EFHYDILAKRLRELSFLNSGVSIKLTDEREEDKKDHFMYEG 220
3 -82.200IDP02606 gene: gyrB; DNA gyrase subunit B [Listeria monocytogenes EGD-e] lmo0006 [Listeria monocytogenes EGD-e]  ali follow..  56  25EGLEAVRKRPGMYIGSTS-QRGLHHLVWEIVDNAIDEALAGFCTEIEITIEADNSITVRDNGRGIPTGINEKIGRPTVEVIFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTSLEVYVHREGQKYYQRFERGDVVMDMEEQGETDYRGTIVHFTPDPQIFTETTEFDFDTLRTRTRELAFLNRGLTISIEDKREEHKVRKDF... 228
4 -79.800IDP04572 DNA gyrase subunit B [Bacillus anthracis str. Sterne] BAS0005 [Bacillus anthracis str. Sterne]  ali follow..  59  20EGLEAVRKRPGMYIGSTS-GKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSIRVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHREGKIHYQKYERGIPVADLKVIGDTDQTGTITRFKPDPEIFQETTVYEFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEG 226
5 -77.700IDP02529 gene: gyrB; DNA gyrase subunit B [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0003 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  57  14KGLEAVRKRPGMYIGDTN-IGGLHHMIYEVVDNSIDEAMAGHCDTIDVEITTEGSCIVSDNGRGIPVDMHPTENMPTLTVVLTVLHAGGKFDKDTYKVSGGLHGVGVSVVNALSKKLVATVERNGEIYRQEFSEGKVISEFGVIGKSKKTGTTIEFWPDDQIFEVT-EFDYEILAKRFRELAYLNPKITINFKDNRVGKHESFHFEGG 219
6 -75.300IDP90817 DNA topoisomerase IV subunit B [Vibrio cholerae O1 biovar eltor str. N16961] VC2431 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  47  14NGLEPVRRRPGMYTDTT----RPNHLGQEVIDNSVDEALAGYASKIQVILHADQSLEVIDDGRGMPVDIHPEEKVSGVELILCKLHAGGKFSNKNYQFSGGLHGVGISVVNALSKRVEVAVRRDGQVYEIAFEHGDKVTELTVTGTRRNTGTSVHFWPDTKYFDSP-NFSVSRLINNLRAKAVLCPGLEIIFTDKVNNNEHRWLYEDG 218
7 -73.400IDP05229 gene: parE; DNA topoisomerase IV subunit B [Listeria monocytogenes EGD-e] lmo1286 [Listeria monocytogenes EGD-e]  ali follow..  47  15EGLEAVRKRPAMYIGSTD-VRGLHHLVYEIVDNSVDETLAGFGKKIVVTLHEDGSVSVSDEGRGMPVGMHKTGKSTVEVILTVLHAGGKFGQEGGYKTSGGLHGVGSSVVNALSEWLVVTINRDGATYQQKFKDGGPDGTLKKIGKSKATGTTIRFKPDPAIFPTT-SFNYETLSERLRESAFLLKGMLIELIDERVGMAEAFHFEEG 221
8 -60.400IDP92142 DNA topoisomerase II, putative [Toxoplasma gondii ME49] TGME49_112230 [Toxoplasma gondii ME49]  ali follow..  26  45SQLEHILLRPDTYIGSTEVVPGLYKIVDEILVNAADKPGARRMSAIKIDINASGRITIWNDGEGIPVAIHQEHKVYVPEMIFGQLLTSDNYDDSECRVTGGRNGYGAKLTNIFSREFTVECGERKKKFKMTWTKNMEQKSESEISSNGTDYVKISFIPDFAKFGMTDDDSLSLLRKRAYDLAG-TSGVKVFLNGTRIDINSFSQYVD. 292
9 -46.700IDP92137 DNA gyrase subunit B, putative [Toxoplasma gondii ME49] TGME49_097780 [Toxoplasma gondii ME49]  ali follow..  41  266EGLEPVRMRPGMYIGSTD-SEGLHHLVWEAIDNAVDEVENGDCRRIVVVLHADRRVTVADDGRGIPCDVHPQTGLSALETVFTKLHAGGKFSPASYAFAGGLHGVGSSVVNALSSQLRVSVLRDGKLHAISFSRGQVVSPLTVQTSPSLSRGNSAPVGDPRPRE--TPNEGAKAESEGDAFAVLPEGNVEAQMRAVEDYVCRFAS... 467
10 -12.200IDP91391 gene: mutL; DNA mismatch repair protein [Vibrio vulnificus CMCP6] VV1_1292 [Vibrio vulnificus CMCP6]  ali follow..  21  18....EVVERPAS-------------VVKELVENSLDSG----ATKIDIDIEKGGAIRIRDNGSGIVKD---------LGLALSR-HATSKIDDLEAIMSLGFRGEALASISSVS-RLTLTSRPATQEQAWSAYTEGRDMQVKLQPTAHPIGTTVEVVPARRKFLRTEKTEFAHIDELLKRIALSCFDVSITLRHN............. 192
11 -10.000IDP04236 sensor histidine kinase [Clostridium perfringens ATCC 13124] CPF_0837 [Clostridium perfringens ATCC 13124]  ali follow..  19  219................YSDEKWVEFIINQVINNSIKYSSKNSRVKIFANKSKNSTLKIKDSGVGIPNKDLGR--------VFEKGFTGEN------RRFTKSTGMGLYLCKNLCDKLGLGLK---------------------ITSKENEGTEVSI.................................................... 325
12 -9.950IDP04431 sensor histidine kinase [Bacillus anthracis str. `Ames Ancestor`] GBAA5088 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  17  214................ASDAKWLKFIIYQLMTNAVRYSGERGKKVFLSAYRNGKDLEVRDEGVGIPQEDIRR--------VFEPFYTGKN------RTFGESTGMGLYIVSKICDYLGHSVK---------------------LDSEVGKGTTIKI.................................................... 321
13 -9.810IDP04556 putative two-component sensor histidine kinase [Yersinia pestis CO92] YPO3008 [Yersinia pestis CO92]  ali follow..  18  392..................DVDRLTQIISNFLSNAEKYASQGKRVELIGEQADDRLIHVRDYGNGIAAKELKA--------IFQPFY---RVKSHITEGVSGT-GIGLTIASQLAASLQGEISVTSNPAGSCFTLKLPMTIKQDAATDKEQFT........................................................ 514
14 -9.430IDP04371 sensor histidine kinase [Bacillus anthracis str. `Ames Ancestor`] GBAA4776 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  18  181KGFHVHIDIPERNIYALGNVEVLGRVLNNFISNAITYGDDGKTLGMTLRDDETNYIDVWDTGKGIDES---------IDKVFERMY---TLEDSRNRLYQG-SGLGLTITKRLVEAMDGKIHLSSK.................................................................................. 295
15 -9.420IDP04660 sensor histidine kinase, putative [Bacillus anthracis str. `Ames Ancestor`] GBAA0286 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  18  181HNIKLQVLMPESTCPIIADHLSLMRIIGNLMKNAIYYGKDGKTIGVELLETDAAELLIWDKGPGIPKH---------LQNVFERMY---RSEQSRNSSFGG-SGLGLSISKAL............................................................................................... 282
16 -9.310IDP04382 sensor histidine kinase [Clostridium perfringens ATCC 13124] CPF_0116 [Clostridium perfringens ATCC 13124]  ali follow..  19  219................YSDSKWIEFILGQIISNSIKYMNKEHKELKIYCNENSKYLNIEDNGAGISEKDISR--------VFDKGFTGEN------RKFGKSTGIGLYLCKKLCKKLGLDIK---------------------LISEEGKFTRVSI.................................................... 326
17 -9.210IDP04104 gene: rstB; two-component regulatory system, sensor kinase protein [Yersinia pestis CO92] YPO2309 [Yersinia pestis CO92]  ali follow..  25  309........................RLMERVLDNLVNNALRYSHQRLRIGLWFDGDLQVEDDGPGIPPEERTR--------IFEPFV---RLDPSRDRATGG-CGLGLAIVHSI............................................................................................... 388
18 -9.170IDP92003 sensor histidine kinase [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100002775 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  29  234..................DYAKLSRILVNLVDNAFKYSAPGTKLEVVAKLEKDQSISVTDEGQGIAPE---------LENIFKRLY---RVETSRNMKTGG-HGLGLAIAREL............................................................................................... 317
19 -9.160IDP04433 sensor histidine kinase [Bacillus anthracis str. `Ames Ancestor`] GBAA5276 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  12  374......................IQTAIFNIISNAIHYTIDHQHVYIKLYEKPNGALEVLNTGSQIDED---------LAHLFEPFY---RANPDKHGLVQG-SGLGLYIVKQIQFPYGIQNTPQGVKCSIVFPKAM........................................................................ 480
20 -9.070IDP04243 sensor histidine kinase [Clostridium perfringens ATCC 13124] CPF_1140 [Clostridium perfringens ATCC 13124]  ali follow..  21  306..................DYSKVKRMLIILLENAFKYTEEGGKISLSFEEVNKNKIIVCDNGIGIKEEDIGR--------IFDRFF---RSADVRGKNIKG-SGIGLSLLKSIGKTLGTDIKLYSKY................................................................................. 403
21 -9.060IDP04304 sensor histidine kinase [Clostridium perfringens ATCC 13124] CPF_2640 [Clostridium perfringens ATCC 13124]  ali follow..  20  198..................DKDKITQALVNILSNAIRYSNEGSTIFIEEKLKDNKIISIEDQGIGISEE---------LKYVFERFY---RADKSRTRATGG-TGIGLTIVKSI............................................................................................... 281
22 -9.060IDP04239 sensor histidine kinase [Clostridium perfringens ATCC 13124] CPF_1057 [Clostridium perfringens ATCC 13124]  ali follow..  22  303................QGDMALLKQTARILVENATKYTEEGEIITLKVGENSKGEFSIQDNGIGMDENDVPH--------IFERFF---RADTARVRKNGG-TGLGLSIAKWI............................................................................................... 389

FFAS is supported by the NIH grant R01-GM087218-01
1 3 1 8 8 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.