current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 5e3i_A mol:protein length:438 Histidine--tRNA ligase, from PDB1018

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430
# Score Template Links and tools%idFirst MAMSSIVAIKGFNDVLPTQTAAWRRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRAIGDATDIVEKEMYTFFDKGNPPESLTLRPEGTAGCVRALVEHNLLRGATPRVWYMGPMFRYEKPQKGRYRQFHQFGVETFGVATPDIDAELIMLTARLWKRMGVDHMVQLELNTLGETDERTEYRNALVAFLNEHKDALDEDSQRRLTTNPLRILDSKIESTQKILENAPKLHDFLKEDSLSHFQQLQDYLTAAGIKFVINQKLVRGLDYYNKTVFEWTTTALGSQGTVCAGGRYDGLVGQLKGKADQSVPAVGFAMGMERLLLLLEQVEQAEIVRDCEAFLVAEPAYQSKALVLAEQLRDQLEAANSNIRIKTGSQGSMKSQMKKADQAGAVYAIILGEREWEAQQLAVKELATAEQSQVALAELVPFLIEKFTKLast
1 -127.000IDP05687 gene: hisS; histidyl-tRNA synthetase [Listeria monocytogenes EGD-e] lmo1520 [Listeria monocytogenes EGD-e]  ali follow..  39  2....DLQLPRGTRDILPEEVSKWHFLETEFKNVCENYQYEEIRTPVFEHTELFERGVGDSTDIVSKEMYTFQDKGG--RSLTLRPEGTASVVRAFVEHKLEVSQPIKMYYNEPMFRYERPQGGRQRQFTQMGIEALGSDDPSIDVEVISLAMEFFRKIGLTN-IKLVINSLGDKESRLKHREALVAHFEPHIDEFCAECQVRLHKNPLRILDCKKDHDNPLIQSAPSILDFLNEESVAYFENVKNYLNALEIPFEIDPTMVRGLDYYNHTTFEIMSVEFGAKTTLCGGGRYHGLVREFGGP---DTPGMGFGIGVERILLALEKADIEIPKPLEVYVITAQPEAELKGVTLVNKLRQNGISAEKDYL-----KRKFKAQLKDANRKNAVYTIILGEEELQTGNYQLKNMETGEQEAVSETTILEKLSNTKGE 424
2 -126.000IDP90816 gene: hisS; histidyl-tRNA synthetase [Yersinia pestis CO92] YPO2878 [Yersinia pestis CO92]  ali follow..  54  2..AKNIQAIRGMNDYLPADTAIWQRIESILKQVLSGYGYSEIRMPIVEQTPLFKRAIGEVTDVVEKEMYTFDDRNG--ESLTLRPEGTAGCVRAGIEHGLLYNQEQRLWYIGPMFRYERPQKGRYRQFHQLGAEVFGLPGPDIDAELILLTARWWRALGIFEHVKLELNSIGSLAARADYREALVAFLEQHVEVLDEDCKRRMYSNPLRVLDSKNPDVQQLLDDAPKLSDYLDEESKQHFAGLCELLDKASIPYTVNERLVRGLDYYNRTVFEWVTHSLGAQGTVCAGGRYDGLVEQLGGR---ATPAVGFAMGLERLVLLVQAVNADFQATVDAYVISSGEGAQSAAMLLAESLRDALPTLKIMTNY---GGGNVKKQFTRADKWGARVALMLGESEVAAQQVVVKDLRNGEQETLAQADVAARLALMLG. 424
3 -121.000IDP90628 gene: hisS; histidyl-tRNA synthetase [Vibrio cholerae O1 biovar eltor str. N16961] VC0760 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  53  2..AKTIQAIRGMNDCLPTQSPLWQKVEGVVKNVISAYGYSEVRMPIVEMTHLFSRAIGEVTDVVEKEMYTFEDRNG--DSLTLRPEGTAGCVRSGIENGLLYNQEQRLWYMGPMFRHERPQKGRYRQFHQCGVEVFGLDGPDVDAELIMMTARLWRELGIAQHVRLELNSIGSLEARANYRTALIDYLEQYQNVLDEDCKRRMYTNPLRVLDSKNPDVQAILGDAPQLSDYLDAESKQHFAGLCELLDAAGIEYTVNQRLVRGLDYYNRTVFEWITESLGSQGTVCGGGRYDGLVEQLGGK---PTPAVGFAMGLERLVLMMETLGNTDRRSVDVYMVTAGEGTMMAGMKLAEQLREQVPGLRVMTHF---GGGNFKKQFKRADKVGAAIALVLGEDEVAAQTVVVKDLAGGEQNTVAQAEVAKLLAHLA.. 422
4 -118.000IDP90766 gene: hisS; histidyl-tRNA synthetase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0765c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  39  2.....INALKGMKDLLDKDAYYYEKVIKICEEVAKNYGFTFINTPHLELCTLFKRSVGESSDIVGKEMYEFIDKGE--NHVCMRPEGTAGVVRAYIEKKLKNTSVKRWFYYGSMFRYERPQKGRLREFHQFGVESLGIPNVYEDASIILMLVEIFSRLGID--FKLQLNSLGCSQCLPKYRDRLVEFLDS-KEGFCEDCLRRKNLNPIRVLDCKNEHCQNLLENAPLLINNLCTSCQKDFETLQQILKDNGVKFELDSKLVRGLDYYSKTAFEFISDEIGAKAAIAGGGRYDRLIEYLGGK---SGYGIGFAMGIERIITILEQKEEKIQ-REGIYLCAMDEIYIQKLLHIATNLRK-EYKVLLSYE-----ARKLAKHLENADKNNTEIFLCMGENEAQNESLFYKNLAKKEEKMIKISDLKKVL...... 408
5 -24.200IDP90551 prolyl-tRNA synthetase [Vibrio cholerae O1 biovar eltor str. N16961] VC0875 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  16  34......KLASGLYTWLPTGLRVLRKVENIVRQEIDNAGAIETLMPVVQPFELWEET--GRSEKMGPELLRFTDRHE--RPFVLSPEVITALVRNEVSS--YKQLPLNLYQIQTKFRDERPRFGRAREFCMMDAYSFDIDKAGLEKAMHVAYCKAFDRMGL-DYRPVLADT-GAIGGNGSHEFHVLAESGEDLIAFSTESDYAANIEKAEAVAPAIERPAPTAKTIAELVEQHGLPIEKTVKTLFVKASDLKLPFIVDRTVAVMNDFGAGAVEDLRNVVEGDPSPCGKGTNYSEKMNCLDSNGKNVILEMGYGIGVSRVVAAAIEQNHDDYAPFQVAIVPMNERVQQAAEKLYAELTAAGIEVLFD------RKERPGVMFSDMELIGVPHTIIIGDRSMDEGHFEYKNRRQGEKEAVAMESIIDFIQAKLA. 571
6 -23.900IDP90927 gene: proS; prolyl-tRNA synthetase [Yersinia pestis CO92] YPO1068 [Yersinia pestis CO92]  ali follow..  14  34......KLASGLYTWLPTGVRVLKKVENIVREEMNNAGAIEVSMPVVQPADLWQES--GRWEQYGPELLRFVDRGE--RPFVLGPEVITDLIRGEINS--YKQLPLNFFQIQTKFRDERPRFGRAREFLMKDAYSFHTTQESLQEAMYTAYSKIFSRMDLN-AVLADTGSIGGSASHEFQVLAESDYAANIEFAEALAPTEPRAPATEELRIVDTPNAKTIAEGHKLVALLVRGDHDLNEIKAEKLPQVAKPLTFASEEEIRERDLALPLVADLRNVVEGDISPDGKGTKYSEVMKAQGEDGRNQVMTMGYGIGVSRVVAAAIEQNHDDRAPFQVAILPMNFRVKELAEELYTTLRSHGIDVILD------RKERPGVMFADMELIGVPHNIVIGDRNLDSEEVEYKNRRVGEKQMIKTSEIVEFLLSQIKR 572
7 -23.300IDP04603 prolyl-tRNA synthetase [Bacillus anthracis str. Sterne] BAS3670 [Bacillus anthracis str. Sterne]  ali follow..  15  34......QNASGIYSFLPFGLKVLHKVERIVREEMERAGAVELLMPAMQAAELWQES--GRWYSYGSELMRMKDRNA--REFALGAEVITDLVRDEVKS--YKKLPLTLYQIQTKFRDERPRFGRGREFLMKDAYSFHATQESLDERLYKAYSNIFARCGLN-AVIADSGAMGGKDTHEKAIEEVSAFLNIEADKCIKSMVFKVDEKLVVVLVRGDHEVNDVKVKNVYGASVVELASHEEVKELLNCEVGSLGPIGVNGDIEIIAD--NGTILFARGIEVGHVFKL--GTRYSEAMNALDENGKTQPLIMGYGIGVSRTVAAIAEQAVAPFHVHVIPVNMKSDAQREMGENIYNSLQEQGYEVLLD------RAERAGVKFADADLFGLPVRVTVG-KKADEGIVEVKVRATGESEEVKVEELQTYIANILK. 566
8 -23.000IDP05230 gene: proS; prolyl-tRNA synthetase [Listeria monocytogenes EGD-e] lmo1319 [Listeria monocytogenes EGD-e]  ali follow..  15  34......QTASGIYSYLPLATLMLRKIETIIREELEAIGAAELLMPALQPAELWQES--GRWNDYGPELMRLKDRAS--RDFALGPEVITALLRDEVKS--YKRLPLTLYQIQTKFRDERPRFGRGREFIMKDAYSFHATSESLDELMHQAYSNIFTRCGLE-SVIADSGSIGGNESKEKSITDIVGFLEVPIEKTMKSMLYQVDDEVIMVLVRGDHEVNDIKIKNALDATNVELVDPAVAVELLGANFGSLGPINVPENMAEGIEV--GHIFKL-------------GTKYSEAMNALDENGRAQPIIMGYGIGVSRILSAIAEQSNDENSPFDLHLIPVNEEQVAFAETLYTSLQDAGFSVLID------RAERAGVKFADADLIGLPIRITVG-KKAAEGVVEVKIRKTGEMIEVRQDELLNTLPILFGD 567
9 -22.900IDP06242 prolyl-tRNA synthetase [Streptococcus pneumoniae TIGR4] NP_344802 [Streptococcus pneumoniae TIGR4]  ali follow..  16  34......QVSAGVYSYLPLANRVIEKAKNIMRQEFEKIGAVEMLAPALLSAELWRES--GRYETYGEDLYKLKNREK--SDFILGPETFTAIVRDSVKS--YKQLPLNLYQIQPKYRDERPRNGRTREFIMKDAYSFHANYDSLDSEYKAAYERIFTRSGLD-AIIGDGGAMGGKDSQEKSIDEVAAFLNVPEEQTIKTLFYIADGELVAALLVGNDQLNEVKLKNHLGADFFDVASEEEVANVVGSLGPVGLPENIVLNFARGIEI--GHIFKL-------------GTRYSASMGALDENGRAVPIIMGYGIGVSRLLSAVMEQHARLFVNKDVHLITVNEEAQALTEKLEASLMGAGYEVLTD------RNERVGVKFSDSDLIGLPIRITVG-KKAADGIVEVKIKATGDTIEVHADNVLETLEILSKK 617
10 -22.000IDP90581 gene: proS; prolyl-tRNA synthetase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0543 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  16  35......QIGSGLYNFLPLGKRVLDKIKNIVKEEMDKAGAQEVNLSFITPASLWQES--GRYNVFGKELLRFKDRKE--NEFVLGPEAMLSLVKNKITS--YKQLPLHLYQIGLKFRDERPRFGRCREFLMKDGYSFHANEEDLGRLMYKTYSQILQRMGL-DFRAVEADS-GAIGGSGSKEFMVLAKNGEDDILICENCDYAANVEAAKRAKKTCQDERP-IKTIDSLAQFFKINAFYTIKAVVKKAGLKDIDFYIDFELENEKQMIMGAFKDLIEVKEGDCCVKCGGQKYSKAMNALDENGKSQPFYMGYGIGVSRLLAVAIEANHDEKAPFVLEIIVSNEKALEFANKLYRDLTNLGLEVLLD------RNERFGVKMNDFELMGFPYALVIG-KGLENNEIELIQREGLVKELIKTDELMEILKKKV.. 568
11 -22.000IDP05650 gene: proS; hypothetical protein Cj0539 [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0543 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  16  35......QIGSGLYNFLPLGKRVLDKIKNIVKEEMDKAGAQEVNLSFITPASLWQES--GRYNVFGKELLRFKDRKE--NEFVLGPEAMLSLVKNKITS--YKQLPLHLYQIGLKFRDERPRFGRCREFLMKDGYSFHANEEDLGRLMYKTYSQILQRMGL-DFRAVEADS-GAIGGSGSKEFMVLAKNGEDDILICENCDYAANVEAAKRAKKTCQDERP-IKTIDSLAQFFKINAFYTIKAVVKKAGLKDIDFYIDFELENEKQMIMGAFKDLIEVKEGDCCVKCGGQKYSKAMNALDENGKSQPFYMGYGIGVSRLLAVAIEANHDEKAPFVLEIIVSNEKALEFANKLYRDLTNLGLEVLLD------RNERFGVKMNDFELMGFPYALVIG-KGLENNEIELIQREGLVKELIKTDELMEILKKKV.. 568
12 -21.900IDP05337 gene: proS; prolyl-tRNA synthetase [Staphylococcus aureus subsp. aureus COL] SACOL1282 [Staphylococcus aureus subsp. aureus COL]  ali follow..  15  34......QSTSGIYSYLPLATRVLNNITAIVRQEMERIDSVEILMPALQQAELWEES--GRWGAYGPELMRLQDRHG--RQFALGPELVTSIVRNELKS--YKQLPMTLFQIQSKFRDERPRFGRGREFIMKDAYSFHADEASLDQDMYQAYSRIFERVGIN-PVVADSGAIGGSHTHEKTAQELADFLGRPVDEIVKTMIFKVDGEYIMVLVRGHHEINDIKLKSYFGTDNIELATQDEIVNLVGAVIDKEIKIYADNFVQDL-DFNVDEYGDFRFILEGEKLSDGSGTKYSESMNALDNQGKAQSLIMGYGIGISRTLSAIVEQNSVTPFDLHLISINPKKDDQRELADALYAEFNTKFDVLYD------RQERAGVKFNDADLIGLPLRIVVG-KRASEGIVEVKERLTGDSEEVHIDDLMTVITNKYDN 565
13 -21.000IDP05146 glycyl-tRNA synthetase [Bacillus anthracis str. Sterne] BAS4784 [Bacillus anthracis str. Sterne]  ali follow..  14  93..KARHRADKLIEDALDAKGIEMVVDGLTFDQMADLMKEHEVKCPDCGSEEFTEIR--QFNLMFKTFQGVTESST---NEIFLRPETAQGIFVNFKNRSMRKKLPFGIGQIGKSFRNETPGNFRTREFEQMELEFFCKPGEDLEAFWRETCKNWLLSLGMTE--------------------------------------------------------------------RLRDHGEEELSHYSNATTDIEFKFPFGWGELWGVASRTDFDLKRHMEHSNEDFNYIDPQTNERYVPYC----------IEPSLGADRVTLAFLCDAYEEEAPYKAAILPLSKKLSEGATEVFAELAKDFMVDF-------DETGSIGKRYRRQDEIGTPFCITYDFDSVEDKAVTVRDRDTMEQVRMPISELKGFLEKKIQ. 457
14 -21.000IDP05339 gene: glyS; glycyl-tRNA synthetase [Staphylococcus aureus subsp. aureus COL] SACOL1622 [Staphylococcus aureus subsp. aureus COL]  ali follow..  14  110................VKGDENFIADGLSFEQMKKIIDDEGIVCPVSKTANWTEIR--QFNLMFKTFQGVTEDST---NEIFLRPETAQGIFVNYKNRSMRKKLPFGIGQIGKSFRNEITPGNRTREFEQMELEFFCKPGEEIENYWKTFASDWLTSLNMSSE-------------------------------------------------------------------RLRDHDEDELSHYSNATTDIEYKFPFGWGELWGIDFDLRKHAEHSGEDFRYHDPETNEKYIPYCIEPSLGADRVTLAFLCDAYDEEGVEGSKDARTVLH-APYKAAILPLSKKLSGEAIKIFEQLSSKFSIDF-------DESQSIGKRYRRQDEIGTPYCVTFDFDSLEDNQVTVRDRDSMEQVRMPISELEAFLTEKTK. 462
15 -20.800IDP05140 prolyl-tRNA synthetase [Bacillus anthracis str. Sterne] BAS0382 [Bacillus anthracis str. Sterne]  ali follow..  11  27AELVDYSSVKGCMILRPYGYALWENMQKVMDEKLKATGHENVYMPMFIPESLLQKEKDH--EGFAPEVAWVTHGGDEAERLCVRPTSETLFCEHFSKIQSYNDLPKLYNQWCSVVRWEKTTRPRTTEFLWQEGHTIHETAEESQ-AETLNILNLYASFCEDYLAIPVIKGQKTEKE-----------------------------------------------------KFAGAKATYTIESLMHDGKALQTGTSHN------FGTNFSEAFDIKFLDRNGKWQYVHQTSWGVSTRMIGGLIMVHSDNNGLVM--------------VAPVQVVIVPIAQHKEGVLAKATELQGHIQKVARVKID-----ASNKTPGWKFNEYEMKGIPIRLEVGPKDIEKNQVVLVRRDTKEKEFISMDQLEERIPALLEE 386
16 -20.200IDP06155 gene: thrS; threonyl-tRNA synthetase [Helicobacter pylori J99] NP_222834 [Helicobacter pylori J99]  ali follow..  15  237.........AGLPLWLPKGARLRKRIEDLLSQALLLRGYEPVKGPEILKSDVWKIS--GHYDNYKENMYFTTIDE---QEYGIKPMNCVGHIKVYQSAHSYRDLPLRFYEYGVVHRHEKSGV-RVREFTQDDAHIFCSFEQIQSSAILDFTHKIMQAFGFSYEMELSTRPAKSIGDDKVWEKA---------------------------------------------------------NALKEALKEHRIDYKIDE----GGGAFYGPKIDIKITDALKRKWQCGTIQVD--LAFTNEYNHAEQPVMAILGSFERFIAILSEH-----APTQIALIPINEEHHVFALKLKEALKKCDIFVEVL-----DKNDSLNKKVRLAEKQKIPMILVLGNEEVETEILSIRDREKQAQYKMPLKEFLNMVESKMQE 609
17 -19.900IDP92033 prolyl-tRNA synthetase, putative [Toxoplasma gondii ME49] TGME49_019850 [Toxoplasma gondii ME49]  ali follow..  14  235.EMIEYYDISGCYIMRPWAFHIWEKVQRFFDDEIKKMGVENSYFPMFVSRHKLEKEKDHVEGF-SPEVAWVTHYGDSPEKIAIRPTSETIMYPAYAK-RSHRDLPLKLNQWCSVVRWEKQPTPRTREFLWQEGHTAHATEEEAWEDILELYRRWYEECLAVPVI------------------------------------------------------------KGEKSEGEKFAGGKKTTTVEAFIPENGRGIQAATSHLLGTNF--AKMFEIEFEDEEGHKRLVHQTSWGCTTRSLGVMIMTHGDDKGLVI------------PRVASVQVVIIPILFKDENTGEILGKCRELKTMLEKADIRVRIDDRSNYTPGWKYNHWEVKGVPLRLELGPKDLAKGTARVVRRDTGEAYQISWADLAPKLLELMEG 600
18 -19.600IDP05080 gene: thrS; threonyl-tRNA synthetase [Listeria monocytogenes EGD-e] lmo1559 [Listeria monocytogenes EGD-e]  ali follow..  16  260.........QGLPLWLPKGATIRRVIERYIVDKEERLGYNHVYTPIMANVELYKTS--GHWDHYHEDMFPTMKMDN--EELVLRPMNCPHHMMIYKNDHSYRELPIRIAELGMMHRYEMSGA-RVRGMTLNDAHVFVRPDQIKDKRVVELILEVYKDFDITDY-SFRLS-------------------------------YRDPKNTEKYFDDDAMWEKA--------------------AMLKSAMDEMEMDYFEAEG-----AFYGPKLDVQVKTAIGKEETLST--RFDLTYIGEDGEKHRPVVIHRGVVSMERFVAYLIEE-----APVQMEIIPVNADALDYAKGVQDKLQRAGLRAEVD-----DRNEKLGYKIREAQTKKIPYALVLGDQEVEAGSVNVRRYGSKDSETMDLDAFIAQVVAEVSK 639
19 -19.300IDP06315 gene: thrS; threonyl-tRNA synthetase [Streptococcus pneumoniae TIGR4] NP_346071 [Streptococcus pneumoniae TIGR4]  ali follow..  16  261.........QGLPFWLPNGATIRRELERYIVNKELVSGYQHVYTPPLASVELYKTS--GHWDHYQEDMFPTMDMGDG-EEFVLRPMNCPHHIQVFKHHHSYRELPIRIAEIGMMHRYEKSGA-RVREMSLNDGHLFVTPEQIQEQRALQLIIDVYEDFNLTDY-RFRLS-------------------------------LRDPQDTHKYFDNDEMWENA--------------------TMLRAALDEMGVDYFEAE----GEAAFYGPKLDIQIKTALGKEETLSTIQLD--LKYIGADGEDHRPVMGVISTMERFTAILIENPTWLAPHQVTLIPVSNEKHVDYAWEVAKKLRDRGVRADVD-----ERNEKMQFKIRASQTSKIPYQLIVGDKEMEDETVNVRRYGQKETQTVSVDNFVQAILADIAN 641
20 -18.800IDP90668 gene: thrS; threonyl-tRNA synthetase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0206 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  15  227.........GGLPIWLSNGARLRSKLEHMLYKIHRLRGYEPVRGPELLKADAWKIS--GHYANYKENMYFTQIDE---QEYGIKPMNCVGHIKIYQSDRSYRDLPLKFFEYGVVHRHEKSGV-RVREFTQDDAHIFCMPSQIKELEILAFVDNLMKLFDFSYEMEISTKPEKAIGDDEIWEIA---------------------------------------------------------KALKEALDEQGLKYGIDEG------FYGPKIDIKITDALKRKWQCGT--RFKLEYTDSDNEKKQPVMLHRAILGFERFIGILTEH-----APTAVGIVPIGEAHIAYAKEIQKELLELNIDSEVY-----EKNESLSKKIRIAEKQKLPMILVLGDDEVAKRSVALRDRRAKEQKNLSLDEFIKLVKEKMSE 599
21 -18.500IDP90813 threonyl-tRNA synthetase [Vibrio cholerae O1 biovar eltor str. N16961] VCA0287 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  15  259......QEAPGMVFWHHNGWSIFRDLEIFIRQKLNEYGYQEVKGPLMMDRVLWERS--GHWDKYADAMFTTSSEN---REYAIKPMNCPGHIQIFNQGKSYRDLPLRMAEFGSCHRNEPSGS-RVRGFTQDDAHIFCTEDQIQQTSCIKMVYDTYTTFGFQNI------------------------------------VVKLSTRPEKRVGSDEIWDKS--------------------QALIDSLKAMDIPFEIQEG------FYGPKIEFTLYDCLDRAWQCGT--RLGATYVGESNERLIPVMIHRAILGLERFIGILIEE-----APEQAVVVNITDKQADYAHEVAQKLQKCGIRAKAD-----LRNEKIGFKIREHTLKRVPYMLVCGDQEMEAGEIAVRTRKGKDLGKFKLDDFIAHIQAEIAS 635
22 -18.500IDP90770 gene: thrS; threonyl-tRNA synthetase [Yersinia pestis CO92] YPO2433 [Yersinia pestis CO92]  ali follow..  16  262..........GMVFWHNDGWTIFRELETFVRMKLKEYQYQEVKGPFMMDRVLWEKT--GHWENYAEHMFTTSSEN---REYCIKPMNCPGHVQIFNQGKSYRDLPLRMAEFGSCHRNEPSGA-RVRGFTQDDAHVFCTEEQVRDNSCIKMVYDMYSTFGFEKI------------------------------------VVKLSTRPEKRIGSDELWTRA--------------------DDLAAALTENGIPFDYQP----GEGAFYGPKIEFTLHDCLDRAWQCGTVQLD--ASYIGENNDRQVPVMAILGSMERFIGILTEE-----APVQVVVMNITDSQSDYVQQVTKKLQDAGIRAKAD-----LRNEKIGFKIREHTLRRVPYMLVCGDKEVESGKIAVRTRRGKDLGSLDVNVVVDQLLAEIRS 634
23 -18.100IDP05712 threonyl-tRNA synthetase [Bacillus anthracis str. Sterne] BAS4472 [Bacillus anthracis str. Sterne]  ali follow..  15  267..........GLPLWLPKGATIRRIIERYIVDKEASLGYDHVYTPVLGSRELYETS--GHWNHYRDGMFPSMEMDN--EELVLRPMNCPHHMMVYKNDHSYRELPIRIAELGTMHRYEMSGA-RVRGMTLNDAHIFVRPDQIKEKRVVNLTLEVYKDFGLENYSF--------------------------------RLSYRDPEDTKKYYADDEMWEKA--------------------GMLKEAMDEMGLDYYEAEG------FYGPKLDVQVRTALGKDETLST--RFELSYVGEDGKQHRPVVIHRGVVSMERFVAFLIEE-----APVQVQVIPVSPQVHDYAKKVQDELRRAGIRVELD-----TREEKIGYKIREAQMQKIPYMLVVGDNEVTENGVNVRKYGEQKSETIALDAFVDMIKVEGKR 645
24 -18.000IDP92018 threonyl-tRNA synthetase, putative [Toxoplasma gondii ME49] TGME49_100260 [Toxoplasma gondii ME49]  ali follow..  15  416..........GSCFWLPDGAKVYNKLCMFMREEYRFRGFQEVISPNIFSCDLWKVS-----QNYKENMYLFDVEG---KEWGLKPMNCPGHCIMFKHLPSYRQLPLRLADFGVLHRNELSGS-RVRRFQQDDAHIFCRLDQVKEADALNFLFFVYDQFGFSFELFLS-KALGERAVWDSAEAALKAALEETGRPWQLNPGDGA---------------------GPKIDIRLWDALKRPHQ-----CGTIQLDFQLPIRF--NLQYRTQDEAVAGARDKAKEDKETG--EAFGVELPLRPGMARPVIIHRAILGIERMCAVVIEH-----SPKQCIVLPISDKVNDYAASVRDVLHSCGYEVGLD-----VSNNTVNKKIREAQLQQWNYLLVVGEKERADKTVTVRDRADPEHQVLSMEDLLTLFEKQGMP 828
25 -17.600IDP05335 threonyl-tRNA synthetase [Bacillus anthracis str. Sterne] BAS2222 [Bacillus anthracis str. Sterne]  ali follow..  16  265..........GMPFYLPKGQIIRNELEAFLREIQKEYNYQEVRTPFMMNQEVWERS--GHWGHYKDNMYFSEVDN---KSFALKPMNCPGHMLMFKNKHSYRELPIRMCEFGQVHRHEFSGA-RVRTFCQDDAHLFVTPEQIEDKSVMAQIDYVYKTFGFEYEVELSTRPEDSMGDDELWEQA---------------------------------------------------------ASLENVLQSLNYKYRLNEG------FYGPKIDFHIKDALNRSHQCGT--KFDLNYIDEKNEKRRPVVIHRAVLGLDRFLAILIEH-----APVQVKVIPVSNAVHQYADEVADKLAQAGVRVERD-----MRDEKLGYKIREAQMQKVPYVLVIGDKEMENGAVNVRKYGEEKSGVIELDMFVESMKEEINN 637
26 -12.500IDP01693 gene: yjeA; lysyl-tRNA synthetase [Salmonella typhimurium LT2] STM4344 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  12  14.................PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQA-----VTDIHLFPFETRFVGPGHSQGINLYLMTSPEY---HMKRLLAAGCG-----PVFQLCRSFRNEEMGRHHNPEFYRPHYDMYRLMNEVDDLLQQVLDCQPAESLSYQQAFQRHLEIDPLSADKTQLREAAAKLDLSNIADTEEDRDTLLQLLFTMGVEPHIGKEKPFIYHFPASQASLAQISTEDHRVAERF-------YYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQQPIDQNLLDALAAGLPDCGVALGVDRLVMLALGAESLAD...................................................................................................... 316
27 -12.200IDP05307 lysyl-tRNA synthetase [Yersinia pestis CO92] YPO0362 [Yersinia pestis CO92]  ali follow..  12  14.................ANLLKRAAIMAEIRRFFADRGVLEVETPTMSQA-----VTDIHLVPFETRFVGPGAADGLTLYMMTSPEYH---MKRLLAAGSG-----PIYQLGRSFRNEEAGRYHNPEFYRPHYDMYRLMNEVDDLLQQILDCNSAETLSYQQAFLRHLNIDPLSAEKAQLREVAAKLDLSNIADTEEDRDTLLQLLFTVGVEPYIGRDKPFIYHFPASQASLAEISTEDHRVAERF-------YFKGIELANGFRELTDGDEQLQRFEQDNRNRAKRGLPQNPIDMNLIAALKQGLPDCGVALGVDRLVMLALNAERLSD...................................................................................................... 316
28 -12.200IDP05569 asparaginyl-tRNA synthetase [Bacillus anthracis str. Sterne] BAS4454 [Bacillus anthracis str. Sterne]  ali follow..  13  135...................FRVRSIAAFAIHQFFQERGFVHVHTPIIEMFRVTTQDLNNVPKGEDGQVDESKDFFGKETNLTVSGQLNAEAYALAFR---------DVYTFGPTFRAENSNTTRHAEFWMVEPEIAFAE------DVMNLTEDMLKYAYVLEHAPEEMEFFN-SFVDKTVLERMNNVINSDFGRITYTEAIKVLQESGADFKYPVEWGIDLQTEHERYLSEEIFKRPVFVTDYPKDIKAFYMRLNDDGKTVAATDLLVPGIGE-----------LIGGSRMDVLVDRIKELGMNETKHAGFGLGFERFLMYITGMANIRD...................................................................................................... 450
29 -12.100IDP90728 gene: asnC; asparaginyl-tRNA synthetase [Yersinia pestis CO92] YPO1412 [Yersinia pestis CO92]  ali follow..  15  138...................ARVRHTLAQAIHRFFDENGYFWVSTPLITASEMFRGAVDFSEDFFGKEAF-----------LTVSGQLNGETYACALS---------KVYTFGPTFRAENSNTSRHAEFWMVEPEVAFAS------DVAGLAEKMLKYVAVLNERADDMKFFA-ERVDKDAVDRLQRFVTSDFAQVDYTDAIEILLASGQKFENDVSWGIDLSSEHERYLAEKHFKAPVVVKNYPKDIKAFYMRMNEDGKTVAAMDVL-----------APGIGEIIGGSRLDVLDARLAEMGLNKVPHSGFGLGFERLISYVTGVQNVRD...................................................................................................... 453
30 -11.900IDP05239 gene: ansB; asparaginyl-tRNA synthetase [Listeria monocytogenes EGD-e] lmo1896 [Listeria monocytogenes EGD-e]  ali follow..  13  130...................MKIRNEIIRASYEFFNKEGFLKIDPPILTGSAPEGTTELFHTKYFEEDAF-----------LSQSGQLYMEAAAMAFG---------KVFSFGPTFRAEKSKTRRHIEFWMIEPEMAFYK------DSLQVQENYVAFL------------VKAVLDNCRLELDRLGRDVSHLEKMVAPFPRITYTEAIERLHELGFDDIVWGDDFGAPHETAIADSFEKPVFITHYPKAIKPFYMPNDQVVLCADMIA-----------EGYGEIIGGSDLETLQARMEDFDLDQVPHSGFGLGLERTVAWISGTEHVRE...................................................................................................... 417
31 -11.800IDP90531 RecName: Full=Asparaginyl-tRNA synthetase; AltName: Full=Asparagine--tRNA ligase; Short=AsnRS Q9KSF9 [Vibrio cholerae]  ali follow..  14  138...................ARVRNCLAQAIHRFYHEQGYFWVSAPLIEMFRVSTLDMENLPRTDAGKVDYNQDFFGKETFLTVSGQLNAEAYACAIS---------KVYTFGPTFRAENSNTSRHAEFWMVEPEVAFAD------TVAKLAEDMLKYVAVLAERRDDLEFFN-DRINNEVIARLEQFVESDFAQVDYTDAIEILKNCGKTFEFPVEWGIDLASEHERFLAEEHFKAPVIVKNYPKDIKAFYMRMNEDGKTVAAMDVL-----------APGIGEIIGGSRLDILDARMREFGIDPVPHAGFGLGFERLVSYVTGMGNVRD...................................................................................................... 453
32 -11.600IDP05209 gene: asnC; asparaginyl-tRNA synthetase [Staphylococcus aureus subsp. aureus COL] SACOL1494 [Staphylococcus aureus subsp. aureus COL]  ali follow..  14  130...................MKIRNEVIRATYEFFNKDGFTKVDPPILTASAPEGTSELFHTKYFDQDAF-----------LSQSGQLYLEAAAMAHG---------KVFSFGPTFRAEKSKTRRHIEFWMIEGEMAFTN------ESLEIQEQYVTHVSVLENCKLELKILERDTSKLEKVATPFPRIS--------------YDDAIEFLKAEGFDDIEWGEDFGAPHETAIANHYDLPVFITNYPTKIKPFYMQNEETVLCADLIAPE----------GYGEIIGGSDLELLEQRVKEHGLDEVPHCGFGLGLERTVAWISGVEHVRE...................................................................................................... 417
33 -10.900IDP05333 aspartyl-tRNA synthetase [Bacillus anthracis str. Sterne] BAS2031 [Bacillus anthracis str. Sterne]  ali follow..  16  132...................FKVKSTLVQSFSELLIENDFTRIFTPKIVSQGAEGGANVFKLPYFQKEAY-----------LAQSPQF---YKQMMVAGGLE-----RVFEIAPVYRAEHHNSSRHNEYISLDVELGFIHD-----EVMQLETDVLRYMQVAKNCEKELQLLQIE--KITLLEAQEILKSKYCKESPVGDDTEGEKLLGKYVKETYKSEFVFITHYPKEARPMYTMPNNENSAITDSFD-----------LYKGLEITSGAQ-RIHNYEMLLDSFKEKGLHPDKFQSYLNTFRYGCPPHGGFGIGLERIVYKLLELSNVRE...................................................................................................... 419
34 -9.560IDP04618 phenylalanyl-tRNA synthetase subunit alpha [Bacillus anthracis str. Sterne] BAS4456 [Bacillus anthracis str. Sterne]  ali follow..  16  111.......................TAVVEQIEDVFIGMGYEVAEGTEVEKDYYNFEALNLPKDHPARDM---QDTFYITEETLLRTHTSSVQARTMENNK--EKGPIKIICPGKVYRRDDDDATHSHQFMQ--IEGLVIDKNIRMSDLKGTLQVFVKKM-FGEDREIRLR--------------------------------------------------------PSFFPFT------------------------EPSVEMDISCMMCHGKGCGTCKGTGWIEILGAGMVHPNVLEMAGYDSKEYQGFAFGMGAERIAMLK.............................................................................................................. 321
35 -9.560IDP05680 gene: pheS; phenylalanyl-tRNA synthetase subunit alpha [Listeria monocytogenes EGD-e] lmo1221 [Listeria monocytogenes EGD-e]  ali follow..  17  111.......................TQVIEEMEDMFIGMGYEIAEGPEVELDYYNFEALNLPKDHPARDM---QDSFYITENTLLRTQ-TSPVQARTMEKHDFSKGPIKVICPGKVYRRDNDDATHSHQFTQ--IEGLVVGENITFADLKGTLTVLAKTMFGEE-REIRLR--------------------------------------------------------PSFFPF------------------------TEPSVEMDISCFKCGGKGCRVCKGTGWIEILGSGMVHPNVLEMSGIDSTRYSGFAFGLGPERVAMLK.............................................................................................................. 322
36 -9.060IDP90630 gene: aspS; aspartyl-tRNA synthetase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0640c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  13  133............NPKLYENFALRSKACIAARNSLANMGFLEVETPILTKA---------TPEGARDYLVPSRVHQGEFYALPQSPQL---FKQLLMCSGFD-----RYFQIAKCFRDEDLRADRQPEFTQIDVEM----SFCEQKDVIKVAETFLKDIACGKEIQTPFRQMQYKDAMENYGSDKPDLRFDLKFIDVIDIFTKSNNEIFANIAKDTKKNRIKAIRVPKGDTIFSKRQMQRFEEFVRKFGAQGLAFEDLNELSKRCELEVGDVVFFGAGAKKTVLDYMGSIAYDVVLNELGGGSIR--PHGGIAIGLDRLIMLVTGA----NSIREVIAFPKTQRAQCLMTDAPSPASNEAMR....................................................................... 572

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 8 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;