current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 1v7o_A mol:protein length:165 alanyl-tRNA synthetase, from PDB1018

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .
# Score Template Links and tools%idFirst MYSIEVRTHSALHVVKGAVVKVLGSEAKWTYSTYVKGNKGVLIVKFDRKPSDEEIREIERLANEKVKENAPIKIYELPREEAEKMFGEDMYDLFPVPEDVRILKVVVIEDWNVNACNKEHTKTTGEIGPIKIRKVRFRKSKGLLEIHFELLELENPSLELast
1 -58.300sp|Q5JTZ9|SYAM_HUMAN Alanyl-tRNA synthetase, mitochondrial OS=Homo sapiens GN=AARS2 PE=1 SV=1  ali   20  25.RLGCMAKHTATHLLNWALRQTLGPGTEQQGS-HLNPEQLRLDVTTQTPLTPEQLRAVENTVQEAVGQDEAVYMEEVPLALTAQVPGLRSLD----EVYPDPVRVVSVGQTSVELCCGTHLLRTGAVGDLVIIG-DRQLSKGTTRLLAVTGEQAQQARE 191
2 -52.600sp|P49588|SYAC_HUMAN Alanyl-tRNA synthetase, cytoplasmic OS=Homo sapiens GN=AARS PE=1 SV=2  ali   21  1....IMSNHTATHILNFALRSVLG-EADQKGS-LVAPDRLRFDFTAKGAMSTQQIKKAEEIANEMIEAAKAVYTQDCPLAAAKAIQGRAVFD----ETYPDPVRVVSIGVTSVEFCGGTHLRNSSHAGAFVIVT-EEAIAKGIRRIVAVTGAEAQKALR 165
3 -51.300sp|Q9BTE6|AASD1_HUMAN Alanyl-tRNA editing protein Aarsd1 OS=Homo sapiens GN=AARSD1 PE=1 SV=2  ali follow..  18  102.RFDHMQQHSGQHLITAVADHLFKLKTT---SWELGRFRSAIELDT-PSMTAEQVAAIEQSVNEKIRDRLPVNVRELSLDDPEVEQVSG---RGLPDDHAGPIRVVNIEGVDSNMCCGTHVSNLSDLQVIKILGTE-KGKKNRTNLIFLSGNRVLKWME 251
4 -50.700sp|P49588|SYAC_HUMAN Alanyl-tRNA synthetase, cytoplasmic OS=Homo sapiens GN=AARS PE=1 SV=2  ali   21  148.RRPIMSNHTATHILNFALRSVLG-EADQKGS-LVAPDRLRFDFTAKGAMSTQQIKKAEEIANEMIEAAKAVYTQDCPLAAAKAIQGRAVFD----ETYPDPVRVVSIGVTSVEFCGGTHLRNSSHAGAFVIVT-EEAIAKGIR............... 300
5 -44.400sp|Q5JTZ9|SYAM_HUMAN Alanyl-tRNA synthetase, mitochondrial OS=Homo sapiens GN=AARS2 PE=1 SV=1  ali   17  175.RLGCMAKHTATHLLNWALRQTLGPGTEQQGS-HLNPEQLRLDVTTQTPLTPEQLRAVENTVQEAVGQDEAVYMEEVPLALTAQVPGLRSLD----EVYPDPVRVVSVGVPVAHALDPASQAALQ.................................. 293
6 -40.500sp|P26639|SYTC_HUMAN Threonyl-tRNA synthetase, cytoplasmic OS=Homo sapiens GN=TARS PE=1 SV=3  ali   19  148.EAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIE--NGFYYDMYLEEGGVSSNDFSSLEALCKKIIKEKQAFERLEVKKETLLAMFKYNKFKCRILNEKVNTPTTVYRCGPLIDLCRGPHVRHTGKIKALKIHKNSSADMETLQRIY............ 298
7 -31.700sp|Q9BW92|SYTM_HUMAN Threonyl-tRNA synthetase, mitochondrial OS=Homo sapiens GN=TARS2 PE=1 SV=1  ali   20  133........HSSTHVLGAAAEQFLGAVLC-RGPSTEYGFYHDFFLGKERTIRGSELPVLERICQELTAAARPFRRLEASRDQLRQLFKDNPFKLHLIEETGPTATVYGCGTL-VDLCQGPHLRHTGQIGGLKLLSNSSGAPETLQRVSGIS......... 280
8 -25.700sp|A2RTX5|SYTC2_HUMAN Probable threonyl-tRNA synthetase 2, cytoplasmic OS=Homo sapiens GN=TARSL2 PE=1 SV=1  ali   22  84........HSSAHILGEAMELYYGGHLCYGPPIE--NGFYYDMFIEDRAVSSTELSALENICKAIIKEKQPFERLEVSKEILLEMFKYNKFKCRILNEKVNTTTVYRCGPL-IDLCKGPHVRHTGKIKTIKIFKNS....................... 210
9 -24.700sp|P26639|SYTC_HUMAN Threonyl-tRNA synthetase, cytoplasmic OS=Homo sapiens GN=TARS PE=1 SV=3  ali   20  5........HSSAHIMGEAMERVYGGCLCYGPPI---ENGFYYDMYLEGGVSSNDFSSLEALCKKIIKEKQAFERLEVKKETLLAMFKYNKFKCRILNEKVNTPTTTVYRCGPIDLCRGPHVRHTGKIKALKIHKNSSTYWEGLQRIYGISFPDPKM... 157
10 -20.700sp|Q9NYK5|RM39_HUMAN 39S ribosomal protein L39, mitochondrial OS=Homo sapiens GN=MRPL39 PE=1 SV=3  ali follow..  13  144........RSCAMMMGCVIERAFKDEYMVNLVRAPEVPVISGAFCYDWMPTKENLRSFTKDAHALIYKDLPFETLEVEAKVALEIFQHSKYKVDFIEEKASIVKLHRIGDF-IDVSEGPLIPRTSICFQYEVSAVHNLQPTQPSLIRRFQGVS...... 301
11 -20.000sp|Q5JTZ9|SYAM_HUMAN Alanyl-tRNA synthetase, mitochondrial OS=Homo sapiens GN=AARS2 PE=1 SV=1  ali   24  1.....................................................................................................................GTHLLRTGAVGDLVIIG-DRQLSKGTTRLLAVTGEQAQQARE 41
12 -19.700sp|Q9BW92|SYTM_HUMAN Threonyl-tRNA synthetase, mitochondrial OS=Homo sapiens GN=TARS2 PE=1 SV=1  ali   18  15.........................................FFLGKERTIRGSELPVLERICQELTAAARPFRRLEASRDQLRQLFKDNPFKLHLIEETGPTATVYGCGTL-VDLCQGPHLRHTGQIGGLKLLSNSSSLWRSLQRVSGISFPTTEL... 136
13 -9.580sp|A2RTX5|SYTC2_HUMAN Probable threonyl-tRNA synthetase 2, cytoplasmic OS=Homo sapiens GN=TARSL2 PE=1 SV=1  ali   23  1.............................................................................SKEILLEMFKYNKFKCRILNENTATTTVYRCGPL-IDLCKGPHVRHTGKIKTIKIFKNSSTYWEG................. 66

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 2 3 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rychlewski L, Wilson IA, Lesley SA, Godzik A. XtalPred: a web server for prediction of protein crystallizability. Bioinformatics. 2007 Dec 15;23(24):3403-5. Epub 2007 Oct 5.