current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 4tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase, from PDB1018

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .
# Score Template Links and tools%idFirst MGSSSSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLSFIQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNLLast
1 -58.100sp|Q9Y285|SYFA_HUMAN Phenylalanyl-tRNA synthetase alpha chain OS=Homo sapiens GN=FARSA PE=1 SV=3  ali follow..  16  200.GSWRDRPFKPYNFLAHGVLPDSGHLHPLLKVRSQFRQIFLEMG--FTEMTDNFIESSFWNFDALFQPQQHP-----ARDQHDTFFLRDPAEALQLPMDYVQRVKRTHSQSQGYKYNWKLDEARKNLLRTHTTSASARALYRLAQKPFTPVKYFSIDRVFRNETLDATHLAEFHQIEGVVADHGLTLGHLMGVLREFFTKLGITQLRFKPAYNPYTEPSMEVKKWVEVGNSGVFRPEMLLPMGLPENVIAWGLSLERPTMIKYGINNIRELVGHKVLQMVYDSPL 492
2 -35.800sp|Q15046|SYK_HUMAN Lysyl-tRNA synthetase OS=Homo sapiens GN=KARS PE=1 SV=3  ali follow..  17  174......NKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLPHLHFGLKDKETRYRQRYLDLILNDFVRQIRSKIITYIRSFLDELGFLEIETPMMNII-----PGGAVAKPFITYHNELDMNLYMR------IAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYAD--YHDLMEITEKMVSGMV-SKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKPPTAGWGMGIDRVAMFLTDSNNIKEV.............. 567
3 -31.300sp|P49590|SYHM_HUMAN(removed signalp:1-13) Probable histidyl-tRNA synthetase, mitochondrial OS=Homo sapiens GN=HARS2 PE=1 SV=1  ali follow..  13  11......................CASCTGAVRCQSQVAEAVLTSQLKAHQEKPNFIIKTPKGTRDLSPQHMV-VREKILDLVISCFKRHGAKGMDTPAFELKETLTEKYGEDSGLMYDLKDQGGELLSLRYDLTVPFARYLAMNKVK---KMKRYHVGKVWRRESPTQGRYREFCQCDFDIAGQFDPMAECLKIMCEILSGLQLGDFLIKVN.......................................................................... 200
4 -30.100sp|P12081|SYHC_HUMAN Histidyl-tRNA synthetase, cytoplasmic OS=Homo sapiens GN=HARS PE=1 SV=2  ali follow..  15  2..AERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVKTPKGTRDYSPRQMA-VREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLT---NIKRYHIAKVYRRDNPTRGRYREFYQCDFDIAGNFDPMAECLKIMCEILSSLQIGDFLVKVN.......................................................................... 212
5 -30.000sp|Q6PI48|SYDM_HUMAN Aspartyl-tRNA synthetase, mitochondrial OS=Homo sapiens GN=DARS2 PE=1 SV=1 (Range: 1-300)  ali follow..  14  108......CEAPVESVVQVSGTVISRPTGEIEIKVKTAELLNACKKLPFEIKKTEALRLQYRYLDLRSFQYNLRLRSQMVMKMREYLNLHGFVDIETPTLF------KRTPGGAKEFLVPSREPGKFYSLP------QSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVD--QTGIQSLIEGL........................................................................................ 300
6 -29.500sp|O95363|SYFM_HUMAN Phenylalanyl-tRNA synthetase, mitochondrial OS=Homo sapiens GN=FARS2 PE=1 SV=1  ali follow..  14  78.................................................................LHNQQHHPLWLIKERVKEHFYKQYVGRFGTPLFSVYDNLSPVVTTWQNPADHPSRKKGDNYYLNRTHMLRAHTSAHQWDLLHAGLDAFLVVGDVYRRDQIDSQHYPIFHQLEAVRLAVKLVEFDLKQTLTRLMAHLFGDEIRWVDCYFPFTHPINFHGEWLEVLGCGVMEQQLVNSAGAQDRGWAFGLGLERLAMILYDIPDIRLFWCEDERF....... 339
7 -26.900sp|Q6PI48|SYDM_HUMAN Aspartyl-tRNA synthetase, mitochondrial OS=Homo sapiens GN=DARS2 PE=1 SV=1 (Range: 151-450)  ali follow..  15  4.......................................KLPFEIKNFVKKTEALRLQYRYLDLRSFQYNLRLRSQMVMKMREYLNLHGFVDIETPTLF------KRTPGGAKEFLVPSREPGKFYSLP------QSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVD--QTGIQSLIEGLLQYS.................................................................................... 154
8 -26.800sp|P14868|SYDC_HUMAN Aspartyl-tRNA synthetase, cytoplasmic OS=Homo sapiens GN=DARS PE=1 SV=2  ali follow..  17  106......ANINKESIVDVEGVVRKVNQQDVELHVQKIYVISLAEPEEGRATVNQDTRLDNRVIDLRTSTAVFRLQSGICHLFRETLINKGFVEIQTPKIISAA-----SEGGANVFTVSYF--KNNAYLA------QSPQLYKQMCICADFEKVFSIGPVFRAEDSNTRHLTEFVGLDIEMAFNY-HYHEVMEEIADTMVQIFKGYTMPDPRNPKQSNSYDMFMRGEEILSGAQRIHDPQLHHGIDPPHAGGGIGLERVTMLFLGLHNVRQT.............. 489
9 -26.600sp|Q9BRP7|FDXA1_HUMAN Ferredoxin-fold anticodon-binding domain-containing protein 1 OS=Homo sapiens GN=FDXACB1 PE=2 SV=3 (Range: 301-600)  ali follow..  11  1..................................................................................ESLTGGTSQDVED-FLVSFSELSLLKNPGRDGKEEACEGGQAKICLRPSLLVHVQDVIEVPDFL--SGSLHILSGPVFQKCHILPFTMPAFHETLFILGVNQSLLDHLKGILDSLLTQTLPESSKLSSDYMIRVKTHNFSPDCTEDLIIGSVITSATSVIHKDQCFVFVSMNLDLLAMLVWCISDWRMLWTFDNRF....... 214
10 -25.000sp|Q96I59|SYNM_HUMAN(removed signalp:1-16) Probable asparaginyl-tRNA synthetase, mitochondrial OS=Homo sapiens GN=NARS2 PE=1 SV=3  ali follow..  18  68......RELNFGSSVEVQGQLIKSPSKRVELKAEKIKVIGNCFPIKYKERHPLEYLRQYPHFRCRTNVSILRIRSEATAAIHSFFKDSGFVHIHTPIITSND---EGAGELFQLEPSGKLKVPEENFFNVPAFLTVSGQLH-LEVMSGAFTQVFTFGPTFRAENSQSRHLAEFYMIEAEISFVD-SLQDLMQVIEELFKAT-EHMLKNNFLIISYTEAVEILKQ--ELFGGGLREERYHARSGLTVPHGGFGMGFERYLQCILGVDNIKDV.............. 449
11 -24.300sp|Q9P2K8|E2AK4_HUMAN Eukaryotic translation initiation factor 2-alpha kinase 4 OS=Homo sapiens GN=EIF2AK4 PE=1 SV=3 (Range: 1051-1350)  ali follow..  13  6.................................................................FSIRTAKMQQHVCETIIRIFKRHGAVQLCTPLLLPRNRQIYEHNEA----ALFMDHSGMLVMLPFDLRIPFARYVARNNIL---NLKRYCIERVFRPRKLDRFHPKELLECAFDIVTSTTNSAEIIYTIYEIIQEF.................................................................................... 138
12 -23.800sp|O43776|SYNC_HUMAN Asparaginyl-tRNA synthetase, cytoplasmic OS=Homo sapiens GN=NARS PE=1 SV=1  ali follow..  16  165CQCYNGVLLSTESSVAVYGMLNLTPKGKQAPGGHELSCDFWEL-NLINEESDVDVQLNNRHMMIRGENKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQ-----VEGGATLFKLDYFGEEAFLTQSSQL---------YLETCLPALGDVFCIAQSYRAEQSRTRHLAEYTHVEAECPFLT--FDDLLNRLEDLVCDVVDRILKSPAGRMNYSDAIVWLKE--EIVGGSMRIFDSEKREGIDPTPYGYGLGLERFLTWILNRYHIRDV.............. 536
13 -21.600sp|Q9NSD9|SYFB_HUMAN Phenylalanyl-tRNA synthetase beta chain OS=Homo sapiens GN=FARSB PE=1 SV=3  ali follow..  13  355.........................RADIIHACDIVEDAAIAYG--YNNIQMTLPKTYTIA--------NQFPLNKLTELLRHDMAAAGFTEALTFALCSQEDIADK-DISATKAVHISNPKTAEFVARTTLLPGLLKTIAANRKM-PLPLKLFEISDIVIKDSNTDVGAKNYRHLCAVYYNKNPGFEIIHGLLDRIMQLLDVPPGEDKGGYVI-GRCAEIFARGQSVGKLGVLHPDVITKFELTMPCSSLEINVGPFL.......................... 589
14 -19.400sp|P07814|SYEP_HUMAN Bifunctional aminoacyl-tRNA synthetase OS=Homo sapiens GN=EPRS PE=1 SV=5 (Range: 901-1200)  ali follow..  12  148................................................................ILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVAD--RSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDPIKLNQWCNVVRWEFKHPQRTREFLWQEGHSAEAAEEVLQILDLYAQVYEEL.................................................................................... 300
15 -17.800sp|Q7L3T8|SYPM_HUMAN Probable prolyl-tRNA synthetase, mitochondrial OS=Homo sapiens GN=PARS2 PE=1 SV=1  ali follow..  16  36......................RGRRLLLSRVFQPQNLREDRVLSLQDKSDDLTCKSQRLMLQVHLLPYTVRAMEKLVRVIDQEMQAIGGQKVNMPSLSPAELWQATNDLMGKELLRLRDRHGKEYCLGPTHEEAITALIASQLSYKQLPFLLYQVTRKFRDEPRPRFRGREFYMKDMYTFDSSPTYSLVCDAYCSLFNKLGLPFVKVQADVGTIGGTVSTKTKGIEVGHTFYLGTKYSSIFNAQFTMGCYGLGVTRILAAAIEVLSTEDCVRWPSLLAPYQACL 374
16 -17.200sp|Q9P2K8|E2AK4_HUMAN Eukaryotic translation initiation factor 2-alpha kinase 4 OS=Homo sapiens GN=EIF2AK4 PE=1 SV=3 (Range: 901-1200)  ali follow..  13  157..................................................................SIRTAKMQQHVCETIIRIFKRHGAVQLCTPLLLPRNRQIYEHNEA----ALFMDHSGMLVMLPFDLRIPFARYVARNNILN---LKRYCIERVFRPRKLDRFHPKELLECAFDIVTSTLPTAEIIYTIYEIIQEF.................................................................................... 288
17 -17.000sp|P07814|SYEP_HUMAN Bifunctional aminoacyl-tRNA synthetase OS=Homo sapiens GN=EPRS PE=1 SV=5 (Range: 1051-1350)  ali follow..  1...................................................................PWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVAD---SGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDPIKLNQWCNVVRWEFKHPQRTREFLWQEGHSAFATEEVLQILDLYAQVYEELLAIPVVKGRKTETIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEQNSWGLTTRTIGVMTMVHGDNMGL.............. 243
18 -15.600sp|A2RTX5|SYTC2_HUMAN Probable threonyl-tRNA synthetase 2, cytoplasmic OS=Homo sapiens GN=TARSL2 PE=1 SV=1 (Range: 301-600)  ali follow..  16  47....HTGKIKTIKIFKNSSTYWEGNPE--METLQRIYGISFPDNKMMRDWEKFQEEAKNRDHRKIFLPRGAFIYNTLTDFIREEYHKRDFTEVLSPNMYNSKLWEASG-QHYSENMFTFEIEKDTFALKPMNCPGHCLMFAHRPRSWREPIRFADFGVLHRNELSGTTRVRRFQQDDAHIFCTVEQIEECLQFLQSVYSTFGFSFQLNLST.......................................................................... 279
19 -14.600sp|P26639|SYTC_HUMAN Threonyl-tRNA synthetase, cytoplasmic OS=Homo sapiens GN=TARS PE=1 SV=3 (Range: 301-600)  ali follow..  14  4........................DPKMLKEWEKFQEEAKNRDHRKIGRDQELYFFHELSPGSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTSG-QHYSENMFSFEVEKELFALKPMNCPGHCLMFDHRPRSWREPLRLADFGVLHRNELSGATRVRRFQQDDAHIFCAMEQIEDCLDFLRTVYSVFGFSFKLNLST.......................................................................... 200
20 -13.900sp|Q9BW92|SYTM_HUMAN Threonyl-tRNA synthetase, mitochondrial OS=Homo sapiens GN=TARS2 PE=1 SV=1 (Range: 301-600)  ali follow..  18  23................................................................FFLPRGTRVYNALVAFIRAEYAHRGFSEVKTPTLFSTKLWEQSGRPPSSQSDDSTRHITDTLALKPMNCPAHCLMFAHRPRSWREPLRLADFGALHRAEASGGTRLRCFQQDDAHIFCTTDQLEACLDFLRSVYAVLGFSFRLALST.......................................................................... 196
21 -12.400sp|Q9BW92|SYTM_HUMAN Threonyl-tRNA synthetase, mitochondrial OS=Homo sapiens GN=TARS2 PE=1 SV=1 (Range: 151-450)  ali follow..  18  97....HTGQIGGLKLLSNSSSLWRSSGA--PETLQRVSGISFPTTELLRVWEAWREEAELRDHRRIFLPRGTRVYNALVAFIRAEYAHRGFSEVKTPTLFSTKLWEQSGRPPSSQSDDSTRHITDTLALKPMNCPAHCLMFAHRPRSWREPLRLADFGALHRAEASGGLG.................................................................................................................... 296
22 -12.400sp|P26639|SYTC_HUMAN Threonyl-tRNA synthetase, cytoplasmic OS=Homo sapiens GN=TARS PE=1 SV=3 (Range: 151-450)  ali follow..  18  118....HTGKIKALKIHKNSSTYWEGKAD--METLQRIYGISFPDPKMLKEWEKFQEEAKNRDHRKIFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTSG-QHYSENMFSFEVEKELFALKPMNCPGHCLMFDHRPRSWREPLRLADFGVLHRNELSGA...................................................................................................................... 298
23 -11.700sp|Q9NP81|SYSM_HUMAN Seryl-tRNA synthetase, mitochondrial OS=Homo sapiens GN=SARS2 PE=1 SV=1  ali follow..  19  230................................................................YLRGAGALLQHGLVNFTFNKLLRRGFTPMTVPDLLRGAVFEGCG-ANPSQIYNIDPARFKDLNLAGTAEVGLAGYFMDHTVAFRDPVRMVCSSTCYRAETNTGQRVHHFTKVEMFGVQSSQLLEEFLSLQMEILTELGLHFRVLDMPTQELGLPAYRKGRFGEVTSASNCTDFQSRRLHIMFQ--ATACAVPRLLIA........................ 463
24 -10.500sp|P49591|SYSC_HUMAN Seryl-tRNA synthetase, cytoplasmic OS=Homo sapiens GN=SARS PE=1 SV=3  ali follow..  15  195................................................................FLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEVMQEVA--IGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDPIKYAGLSTCFRQEVGSHGRVHQFEKIEQFVYKSWEMFEEMITTAEEFYQSLGIPYHIVNIVSGSLNHAASKKGAFRELVSCSNCTDYQARRLRIRYG--ATMCATTRTICA---------ILENYQTEKGITV.. 452
25 -9.830sp|P41250|SYG_HUMAN(removed signalp:1-26) Glycyl-tRNA synthetase OS=Homo sapiens GN=GARS PE=1 SV=3 (Range: 151-450)  ali follow..  15  115..........................................................................................................................NMPGYLRPETAQGIFLNFKRLLEFNQGPFAAAQIGNSFRNEISPRSRVREFTMAEIEHF-SEKDHPKFQNVADLHLYLYSAKAQVSGQSARKMRLGDAVEQGVINNTVLGYFIGRIYL-------LTKVGISPDKLRFRQHMENEMAHYACDCWDAE...... 272
26 -9.330sp|A2RTX5|SYTC2_HUMAN Probable threonyl-tRNA synthetase 2, cytoplasmic OS=Homo sapiens GN=TARSL2 PE=1 SV=1 (Range: 451-750)  ali follow..  17  1............................................................................................VLSPNMYNSKLWEASG-QHYSENMFTFEIEKDTFALKPMNCPGHCLMFAHRPRSWREPIRFADFGVLHRNELSGTTRVRRFQQDDAHIFCTVEQIEECLQFLQSVYSTFGFSFQLNLST.......................................................................... 129

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 4 5 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.