current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 5YTA Entity 1(prereleased), from PDB1018

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330
# Score Template Links and tools%idFirst ATLKEKLIAPVAEEETTIPNNKITVVGVGQVGMACAISILGKSLTDELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGVHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVQGMYGIENEVFLSLPCVLNARGLTSVINQKLKDDEVAQLKNSADTLWGIQKDLKDLast
1 -96.800sp|P07195|LDHB_HUMAN L-lactate dehydrogenase B chain OS=Homo sapiens GN=LDHB PE=1 SV=2  ali follow..  97  2ATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKD 333
2 -95.200sp|P00338|LDHA_HUMAN L-lactate dehydrogenase A chain OS=Homo sapiens GN=LDHA PE=1 SV=2  ali follow..  74  2ATLKDQLIYNLL-KEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQ. 331
3 -94.800sp|P07864|LDHC_HUMAN L-lactate dehydrogenase C chain OS=Homo sapiens GN=LDHC PE=2 SV=4  ali follow..  69  2STVKEQLIEKLI-EDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKGEMMDLQHGSLFFSTSKITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPVDILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHWKNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGLYGIKEELFLSIPCVLGRNGVSDVVKINLNSEEEALFKKSAETLWNIQKDLI. 331
4 -94.100sp|Q6ZMR3|LDH6A_HUMAN L-lactate dehydrogenase A-like 6A OS=Homo sapiens GN=LDHAL6A PE=2 SV=1  ali follow..  64  2ATIKSELIKNFA-EEEAIHHNKISIVGTGSVGVACAISILLKGLSDELVLVDVDEGKLKGETMDLQHGSPFMKMPNIVSSKDYLVTANSNLVIITAGARQKKGETRLDLVQRNVSIFKLMIPNITQYSPHCKLLIVTNPVDILTYVAWKLSGFPKNRVIGSGCNLDSARFRYFIGQRLGIHSESCHGLILGEHGDSSVPVWSGVNIAGVPLKDLNPDIGTDKDPEQWENVHKKVISSGYEMVKMKGYTSWGISLSVADLTESILKNLRRVHPVSTLSKGLYGINEDIFLSVPCILGENGITDLIKVKLTLEEEACLQKSAETLWEIQKELK. 331
5 -86.500sp|Q9BYZ2|LDH6B_HUMAN L-lactate dehydrogenase A-like 6B OS=Homo sapiens GN=LDHAL6B PE=1 SV=3  ali follow..  65  51ATVKSELIERFT-SEKPVHHSKVSIIGTGSVGMACAISILLKGLSDELALVDLDEDKLKGETMDLQHGSPFTKMPNIVCSKDYFVTANSNLVIITAGARQEKGETRLNLVQRNVAIFKLMISSIVQYSPHCKLIIVSNPVDILTYVAWKLSAFPKNRIIGSGCNLDTARFRFLIGQKLGIHSESCHGWILGEHGDSSVPVWSGVNIAGVPLKDLNSDIGTDKDPEQWKNVHKEVTATAYEIIKMKGYTSWAIGLSVADLTESILKNLRRIHPVSTIIKGLYGIDEEVFLSIPCILGENGITNLIKIKLTPEEEAHLKKSAKTLWEIQNKLK. 380
6 -69.800sp|Q8IX04|UEVLD_HUMAN Ubiquitin-conjugating enzyme E2 variant 3 OS=Homo sapiens GN=UEVLD PE=1 SV=2  ali follow..  39  171........SKSWANHENKTVNKITVVGGGELGIACTLAISAKGIADRLVLLDLSEG-TKGATMDLEIFN----LPNVEISKDLSASAHSKVVIFTVN-SLGSSQSYLDVVQSNVDMFRALVPALGHYSQHSVLLVASQPVEIMTYVTWKLSTFPANRVIGIGCNLDSQRLQYIITNVLKAQTSGKEVWVIGEQGEDKVLTWSGQEEVVSHT------------------SQVQLSNRAMELLRVKGQRSWSVGLSVADMVDSIVNNKKKVHSVSALAKGYYDINSEVFLSLPCILGTNGVSEVIKTTLKEDTTEKLQSSASSIHSLQQQLK. 470
7 -68.400sp|P40926|MDHM_HUMAN Malate dehydrogenase, mitochondrial OS=Homo sapiens GN=MDH2 PE=1 SV=3  ali follow..  19  18.............STSAQNNAKVAVLGAGGIGQPLSLLLKNSPLVSRLTLYDIAH--TPGVAADLSHIETKAAVKGYLPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLTAACAQHCPEAMICVIANPVNSTIPITFKKHGVYNPNKIFGVTTLDIVRANTFVAELKGLDPARVNVPVIGGHAGKTIIPLISQCTPKVDFPQ-----------DQLTALTGRIQEAGTEVVKAKAGAGSATAYAGARFVFSLVDAMNGKEGVVECSFVKSQETECTYFSTPLLLGKKGIEKNLGIKVSSFEEKMISDAIPELKASIKKGED 332
8 -62.700sp|P40925|MDHC_HUMAN Malate dehydrogenase, cytoplasmic OS=Homo sapiens GN=MDH1 PE=1 SV=4  ali follow..  22  2.................SEPIRVLVTGAGQIAYSLLYSIGNGSVFGKLVLLDIMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIGNHSSTQYPDVNHAKVKLQGKEVGVYE-ALKDDSWLKGEFVTTVQQRGAAVIKRKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFE 329
9 -36.000sp|Q5I0G3|MDH1B_HUMAN Putative malate dehydrogenase 1B OS=Homo sapiens GN=MDH1B PE=2 SV=1  ali follow..  12  113.GAHIEKEQEEEALKTCINPLQVWITSASAACYNLIPILTSGEVFGSITLFDNKQEHLKSLVVETQDLASPVLRSVSICTKVEEAFRQAHVIVVLDDSTNKEVFTLEDCLRSRVPLCRLYGYLIEKNAHESVRVIVGGFVNLKTVLLMRYAPRIAHNIIAV-ALGVEGEAKAILARKLKTAPSYIKDVIIGNISGNNYVDLRKTRVYRYESAIWGPLHYSRFDSEWVKREFVAILKNLTTTGRQFGGILAAHSIATTLKYWYHGSPPGEIVSLGILSEGQFGIPKGIVFSMPVKFENGTWVVLTDLKDVEISEQIMTRMTSDLIQEKLVA.. 457
10 -9.900sp|Q08426|ECHP_HUMAN Peroxisomal bifunctional enzyme OS=Homo sapiens GN=EHHADH PE=1 SV=3  ali   14  140............KTASARPVSSVGVVGLGTMGRGIVISFARARI--PVIAVDSDKNQLATANKMITSVLEKEASKMQQSTSSVKELGGVDLVI--------------EAVFEEMSLKKQVFAELSAVCKPEAFL-CTNTSALDVDEIASSTDRP-HLVIGT........................................................................................................................................................................... 281

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 1 7 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Bossy-Wetzel E, Barsoum MJ, Godzik A., Schwarzenbacher R, Lipton SA. Mitochondrial fission in apoptosis, neurodegeneration and aging. Curr Opin Cell Biol. 2003 Dec;15(6):706-16. Review.