current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 5YXK Entity 1(prereleased), from PDB1018

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# Score Template Links and tools%idFirst SMLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLALast
1 -52.900sp|P42081|CD86_HUMAN(removed signalp:1-23) T-lymphocyte activation antigen CD86 OS=Homo sapiens GN=CD86 PE=1 SV=2  ali follow..  98  1APLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLA 111
2 -49.600sp|Q9H7M9|GI24_HUMAN(removed signalp:1-32) Platelet receptor Gi24 OS=Homo sapiens GN=C10orf54 PE=1 SV=3  ali follow..  13  6PYSLYVCPEGQNVTLTCRLLGPVDKGHVTFYKTWYRSSTFQDLHLHHGGHQAANTSHDLAQRHGLEHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQT 138
3 -48.500sp|Q16653|MOG_HUMAN(removed signalp:1-29) Myelin-oligodendrocyte glycoprotein OS=Homo sapiens GN=MOG PE=1 SV=2  ali follow..  21  8PRHPIRALVGDEVELPCRISPGKNATGMEVGWY-RPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEA-----AMELKVED 117
4 -46.600sp|Q9UIR0|BTNL2_HUMAN(removed signalp:1-26) Butyrophilin-like protein 2 OS=Homo sapiens GN=BTNL2 PE=2 SV=1  ali follow..  20  8PAHPILAGVGEDALLTCQLLPKRTTMHVEVRWY-RSEPSTPVFVHRDGVEVTEMQMEEYRGWVEWIEGNVALKIHNIQPSDNGQYWCHFQDGNYCGET-----SLLLKVAG 117
5 -46.300sp|Q8IWT1|SCN4B_HUMAN(removed signalp:1-30) Sodium channel subunit beta-4 OS=Homo sapiens GN=SCN4B PE=1 SV=1  ali follow..  17  7KATDIYAVNGTEILLPCTFSSCFGFEDLHFRWTYNSSDAILIEGTVKNEKSDPKVTLKDDDRITLVMNNISIVLRDLEFSDTGKYTCHVKNPKENNLQ--HHATIFLQVVD 123
6 -46.100sp|Q8TAG5|VTM2A_HUMAN(removed signalp:1-24) V-set and transmembrane domain-containing protein 2A OS=Homo sapiens GN=VSTM2A PE=2 SV=3  ali follow..  16  8FPRNVTATEGQNVEMSCAFQSGSASVYLEIQWWFLRGPEGAEGAGAQVELLPDRDPDSDGTKISTVKISHKLQISKVRKKDEGLYECRVTDANYGELQE-HKAQAYLKVNA 126
7 -44.200sp|O75144|ICOSL_HUMAN(removed signalp:1-18) ICOS ligand OS=Homo sapiens GN=ICOSLG PE=1 SV=2  ali follow..  19  3QEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSEKTVVTYHIPQNSSLENVDSRYRNRALMSRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSV-EVTLHVAA 118
8 -43.400sp|O60939|SCN2B_HUMAN(removed signalp:1-29) Sodium channel subunit beta-2 OS=Homo sapiens GN=SCN2B PE=1 SV=1  ali follow..  18  5VPATLNVLNGSDARLPCTFNSCYTVNHKQFSLNWTYQECSEEMFLQFRMKIINLKLERFQDRVEFSKYDVSVMLRNVQPEDEGIYNCYIMNPPDRHR---GHGKIHLQVLM 119
9 -43.200sp|Q9UM44|HHLA2_HUMAN(removed signalp:1-22) HERV-H LTR-associating protein 2 OS=Homo sapiens GN=HHLA2 PE=2 SV=1  ali follow..  21  13NEQIVIGRLDEDIILPSSFERG-----SEVVIHWKYQDSYKVHSYYKGSDHLESQDPRYANRTSLFNGNASLFFRRVSLLDEGIYTCYVGTAIQVITN-----KVVLKVGV 118
10 -41.700sp|P33681|CD80_HUMAN(removed signalp:1-34) T-lymphocyte activation antigen CD80 OS=Homo sapiens GN=CD80 PE=1 SV=1  ali follow..  24  2..IHVTKEVKEVATLSCGHNVSVE-ELAQTRIYWQK-EKKMVLTMMSGDM---NIWPEYKNRTIFDTNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKA 106
11 -41.600sp|Q7Z7D3|VTCN1_HUMAN(removed signalp:1-24) V-set domain-containing T-cell activation inhibitor 1 OS=Homo sapiens GN=VTCN1 PE=1 SV=1  ali follow..  23  16TTVASAGNIGEDGILSCTFEPDIKLSDIVIQWL-KEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFVGNASLRLKNVQLTDAGTYKCYIITSKGKGNA-----NLEYKTGA 125
12 -41.500sp|Q9NZQ7|PD1L1_HUMAN(removed signalp:1-18) Programmed cell death 1 ligand 1 OS=Homo sapiens GN=CD274 PE=1 SV=1  ali follow..  17  6PKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEM-EDKNIIQFVHGEEDLKVQHSSYRQRARLLLGNAALQITDVKLQDAGVYRCMISYGGADYK----RITVKVNAPY 116
13 -40.800sp|P78410|BT3A2_HUMAN(removed signalp:1-29) Butyrophilin subfamily 3 member A2 OS=Homo sapiens GN=BTN3A2 PE=1 SV=2  ali follow..  30  7PSGPILAMVGEDADLPCHLFPTMSAETMELKWV-SSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRGKAALRIHNVTASDSGKYLCYFQDGDFYEKA-----LVELKVAA 116
14 -40.500sp|Q6UX41|BTNL8_HUMAN(removed signalp:1-17) Butyrophilin-like protein 8 OS=Homo sapiens GN=BTNL8 PE=1 SV=1  ali follow..  27  7PDKPVQALVGEDAAFSCFLSPKTNAEAMEVRFF-RGQFSSVVHLYRDGKDQPFMQMPQYQGRTKLVKGRISLRLENITVLDAGLYGCRISSQSYYQKA-----IWELQVSA 116
15 -40.400sp|Q6UXE8|BTNL3_HUMAN(removed signalp:1-17) Butyrophilin-like protein 3 OS=Homo sapiens GN=BTNL3 PE=2 SV=2  ali follow..  25  7PGKFVQALVGEDAVFSCSLFPETSAEAMEVRFF-RNQFHAVVHLYRDGEDWESKQMPQYRGRTEFVKGRVSLRLKNITPSDIGLYGCWFSSQIYDEEATW-----ELRVAA 116
16 -40.400sp|Q6UWV2|MPZL3_HUMAN(removed signalp:1-31) Myelin protein zero-like protein 3 OS=Homo sapiens GN=MPZL3 PE=1 SV=1  ali follow..  16  5ADAHVRGYVGEKIKLKCTFKSTSDVT-DKLTIDWTYRPSHTVSIFHYQSFQYPTTAGTFRDRISWVKGDASISISNPTIKDNGTFSCAVKNPPDVHH---NIPMTELTVTE 118
17 -40.000sp|Q6UXG8|BTNL9_HUMAN(removed signalp:1-34) Butyrophilin-like protein 9 OS=Homo sapiens GN=BTNL9 PE=2 SV=1  ali follow..  23  9PEYPILALVGEEVEFPCHLWPQLDAQQMEIRWF-RSQTFNVVHLYQEQQELPGRQMPAFRNRTKLVKGSVVLQLHSIIPSDKGTYGCRFHSDNFSGEALW-----ELEVAG 118
18 -39.900sp|Q01151|CD83_HUMAN(removed signalp:1-19) CD83 antigen OS=Homo sapiens GN=CD83 PE=1 SV=1  ali follow..  14  1.TPEVKVACSEDVDLPCTAPWDPQV---PYTVSWVKLLGGEERMETPQEDHLRGQHYHQKGQNGSFDRPYSLKIRNTTSCNSGTYRCTLQDPDGQRN---LSGKVILRVTG 109
19 -39.800sp|O00481|BT3A1_HUMAN(removed signalp:1-29) Butyrophilin subfamily 3 member A1 OS=Homo sapiens GN=BTN3A1 PE=2 SV=3  ali follow..  30  7PSGPILAMVGEDADLPCHLFPTMSAETMELKWV-SSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRGKAALRIHNVTASDSGKYLCYFQDGDFYEKALV-----ELKVAA 116
20 -39.700sp|O60487|MPZL2_HUMAN(removed signalp:1-26) Myelin protein zero-like protein 2 OS=Homo sapiens GN=MPZL2 PE=1 SV=1  ali follow..  20  5TSRVLEAVNGTDARLKCTFSSFAPVG-DALTVTWNFRPGPEQFVFYYHIDPFQPMSGRFKDRVSWDRYDASILLWKLQFDDNGTYTCQVKNPPDVDG---VIGEIRLSVVH 118
21 -39.400sp|Q13410|BT1A1_HUMAN(removed signalp:1-26) Butyrophilin subfamily 1 member A1 OS=Homo sapiens GN=BTN1A1 PE=1 SV=3  ali follow..  21  8PPEPILAVVGEDAELPCRLSPNASAEHLELRWF-RKKVSPAVLVHRDGREQEAEQMPEYRGRATLVQGRVALRIRGVRVSDDGEYTCFFREDGSYEEALV-----HLKVAA 117
22 -39.300sp|Q7KYR7|BT2A1_HUMAN(removed signalp:1-28) Butyrophilin subfamily 2 member A1 OS=Homo sapiens GN=BTN2A1 PE=1 SV=3  ali follow..  23  7PTDPILATVGENTTLRCHLSPEKNAEDMEVRWF-RSQFSPAVFVYKGGRERTEEQMEEYRGRTTFVSGSVALVIHNITAQENGTYRCYFQEGRSYDEAIL-----HLVVAG 116
23 -38.900sp|Q9NY72|SCN3B_HUMAN(removed signalp:1-24) Sodium channel subunit beta-3 OS=Homo sapiens GN=SCN3B PE=1 SV=1  ali follow..  18  5VPSETEAVQGNPMKLRCISCMKREEVEATTVVEWFYRPGGKDFLIYEYRNGHQEVESPFQGRLQWNLQDVSITVLNVTLNDSGLYTCNVSREFEFEAHRPFVRLIPLRVTE 123
24 -38.700sp|O00478|BT3A3_HUMAN(removed signalp:1-29) Butyrophilin subfamily 3 member A3 OS=Homo sapiens GN=BTN3A3 PE=1 SV=1  ali follow..  30  7PSGPILAMVGEDADLPCHLFPTMSAETMELRWV-SSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRGKAALRIHNVTASDSGKYLCYFQDGDFYEKALV-----ELKVAA 116
25 -38.700sp|Q96GW7|PGCB_HUMAN(removed signalp:1-22) Brevican core protein OS=Homo sapiens GN=BCAN PE=1 SV=2  ali   14  19GDAPLQGVLGGALTIPCHVSRRAVLGSPRVKWTFLSRGEAEVLVARGVRVK---VNEAYRFRVALPATDVSLALSELRPNDSGIYRCEVQHGIDDSSDAVEVKVKGV.... 135
26 -38.700sp|Q07699|SCN1B_HUMAN(removed signalp:1-19) Sodium channel subunit beta-1 OS=Homo sapiens GN=SCN1B PE=1 SV=1  ali follow..  13  5VDSETEAVYGMTFKILCISCKRRSETNAETFTEWKGTEEFVKILRYENEVLQLEEDERFEGRVVWNLQDLSIFITNVTYNHSGDYECHVYRLENYEHNTSVVKKIHIEVVD 129
27 -38.600sp|Q96N03|VTM2L_HUMAN(removed signalp:1-24) V-set and transmembrane domain-containing protein 2-like protein OS=Homo sapiens GN=VSTM2L PE=2 SV=1  ali follow..  21  22TPHDMTARTGEDVEMACSFRGSGSPSYSLEIQWWYVRSHKQAWASNQLKASQQEDAGKEATKISVVKISHKLRLSRVKPTDEGTYECRVIDFS-DGKARHHKVKAYLRVQP 141
28 -38.600sp|A6NLU5|VTM2B_HUMAN(removed signalp:1-28) V-set and transmembrane domain-containing protein 2B OS=Homo sapiens GN=VSTM2B PE=2 SV=2  ali follow..  18  5VPKDVTVREGDDIEMPCAFRASGATSYLEIQWWYLKEPPRELLHELALSVPGARSKVTNKDATKISTISHRLRLSAVRLQDEGVYECRVSDYS-DDDTQEHKAQAMLRVLS 122
29 -38.100sp|Q8WVV5|BT2A2_HUMAN(removed signalp:1-32) Butyrophilin subfamily 2 member A2 OS=Homo sapiens GN=BTN2A2 PE=2 SV=2  ali follow..  22  7PANPILAMVGENTTLRCHLSPEKNAEDMEVRWF-RSQFSPAVFVYKGGRERTEEQMEEYRGRITFVSGSVALVIHNVTAQENGIYRCYFQEGRSYDEAIL-----RLVVAG 116
30 -37.700sp|Q96KV6|BT2A3_HUMAN(removed signalp:1-27) Butyrophilin subfamily 2 member A3 OS=Homo sapiens GN=BTN2A3 PE=2 SV=2  ali follow..  25  7PTDPILAMVGENTTLRCCLSPEENAEDMEVRWF-QSQFSPAVFVYKGGRERTEEQKEEYRGRTTFVRGSVALIIHNVTAEDNGIYQCYFQEGRSCNEA-----ILHLVVAG 115
31 -37.600sp|Q5SQ64|LY66F_HUMAN(removed signalp:1-16) Lymphocyte antigen 6 complex locus protein G6f OS=Homo sapiens GN=LY6G6F PE=1 SV=2  ali follow..  17  3NMQAIYVALGEAVELPCPSPPTLH---GDEHLSWFCSPTTLVAQVQVGRPAPDPGKPGRESRLRLL-GNYSLWLEGSKEEDAGRYWCAVLGQHHNYQN---WRVYDVLVLK 111
32 -37.500sp|P25189|MYP0_HUMAN(removed signalp:1-29) Myelin protein P0 OS=Homo sapiens GN=MPZ PE=1 SV=1  ali follow..  14  5TDREVHGAVGSRVTLHCSFWSSEWVS-DDISFTWRGGRDAISIFHYAKGQPYIDEVGTFKERIQWVWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVG---KTSQVTLYVFE 119
33 -37.000sp|Q9UKJ1|PILRA_HUMAN(removed signalp:1-19) Paired immunoglobulin-like type 2 receptor alpha OS=Homo sapiens GN=PILRA PE=1 SV=3  ali follow..  17  19.PKHLSASMGGSVEIPFSFYPWELATAPDVRISWRRGHFHRQSFYSTRP---PSIHKDYVNRLFLNQKSGFLRISNLQKQDQSVYFCRVETRSSGRQQWQSIEGTKLSITQ 132
34 -37.000sp|O95297|MPZL1_HUMAN(removed signalp:1-37) Myelin protein zero-like protein 1 OS=Homo sapiens GN=MPZL1 PE=1 SV=1  ali follow..  15  5TPKEIFVANGTQGKLTCKFKST-STTGGLTSVSWEGADTTVSFFHYSQGQVYLGNYPPFKDRISWAKKDASINIENMQFIHNGTYICDVKNPPDIVV---QPGHIRLYVVE 119
35 -36.200sp|O14594|NCAN_HUMAN(removed signalp:1-22) Neurocan core protein OS=Homo sapiens GN=NCAN PE=2 SV=3  ali   21  21GSGSVQAALAELVALPCLFTPRPSAARDAPRIKWTKSGQRQDLPILVAKDNVVRVAKSWQGRVSLPRANATLLLGPLRASDSGLYRCQVVRGIEDEQDLVPLEV....... 135
36 -35.900sp|Q9BQ51|PD1L2_HUMAN(removed signalp:1-19) Programmed cell death 1 ligand 2 OS=Homo sapiens GN=PDCD1LG2 PE=1 SV=2  ali follow..  18  7PKELYIIEHGSNVTLECNFDTGSHVN---------------LGAITASLQKVENDTSPHRERATLLEGKASFHIPQVQVRDEGQYQCIIIYGVAWDYK-----YLTLKVKA 102
37 -35.900sp|Q8TDQ0|TIMD3_HUMAN(removed signalp:1-21) Hepatitis A virus cellular receptor 2 OS=Homo sapiens GN=HAVCR2 PE=1 SV=3  ali follow..  18  1SEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWG---KGACPVFECGNVVLRTDERDVNYWTSRDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMNDEKF---NLKLVIKP 110
38 -35.400sp|P04216|THY1_HUMAN(removed signalp:1-19) Thy-1 membrane glycoprotein OS=Homo sapiens GN=THY1 PE=1 SV=2  ali follow..  18  3VTSLTACLVDQSLRLDCRHENTSS-SPIQYEFSLTRETKKHVLFGTVGV-----PEHTYRSRTNFTYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLV 109
39 -35.200sp|P16112|PGCA_HUMAN(removed signalp:1-16) Aggrecan core protein OS=Homo sapiens GN=ACAN PE=1 SV=2  ali   15  19QPSPLRVLLGTSLTIPCYFTTAPSTAPLAPRIKWSRVSKEKEVVLLVATEGRVRVNSAYQDKVSLIPSDATLEVQSLRSNDSGVYRCEVMHGIEDSEATLEVVVKGI.... 137
40 -34.700sp|Q9BRK3|MXRA8_HUMAN(removed signalp:1-19) Matrix-remodeling-associated protein 8 OS=Homo sapiens GN=MXRA8 PE=1 SV=1  ali follow..  18  19SESAVSWEAGARAVLRCQSPRQDRLHDRQRVLHWDLRGRRLLDLYSAGEQR--VYEARDRGRLELSDGNFSLLIRAVEETDAGLYTCNLHHHYCHLYESL---AVRLEVTD 139
41 -34.400sp|Q86YT9|JAML1_HUMAN(removed signalp:1-19) Junctional adhesion molecule-like OS=Homo sapiens GN=AMICA1 PE=1 SV=1  ali follow..  15  7SPPELTVHVGDSALMGCVFQSTEDKCIFKIDWTLSPGEHAKDEYVLYYYSNLSVPIGRFQNRVHLMCNDGSLLLQDVQEADQGTYICEIRLKGESQVFKKAVVLH...... 115
42 -33.900sp|Q9UKJ0|PILRB_HUMAN(removed signalp:1-19) Paired immunoglobulin-like type 2 receptor beta OS=Homo sapiens GN=PILRB PE=1 SV=1  ali follow..  15  19.PKHLSASMGGSVEIPFSFYPWELAIVPNVRISWRRGHFHGQSFYSTRP---PSIHKDYVNRLFLNQESGFLRISNLRKEDQSVYFCRVETRRSGRQQLQSIKGTKLTITQ 132
43 -33.800sp|Q71H61|ILDR2_HUMAN(removed signalp:1-20) Immunoglobulin-like domain-containing receptor 2 OS=Homo sapiens GN=ILDR2 PE=2 SV=1  ali   23  6PDKKKVAMLFQPTVLRCHFSTSSH---QPAVVQWKLDSRRTVRVVASKQGSTVTLGDFYRGREITIVHDADLQIGKLMWGDSGLYYCIITTPDDLE----NEDSVELLVLG 147
44 -33.600sp|P13611|CSPG2_HUMAN(removed signalp:1-20) Versican core protein OS=Homo sapiens GN=VCAN PE=1 SV=3  ali   19  8KSPPVRGSLSGKVSLPCHFSPPSYNTSEFLRIKWSKIEETTVLVAQNGNIK---IGQDYKGRVSVPVGDASLTVVKLLASDAGLYRCDVMYGIEDTQDTVSLTVD...... 128
45 -33.100sp|P10747|CD28_HUMAN(removed signalp:1-18) T-cell-specific surface glycoprotein CD28 OS=Homo sapiens GN=CD28 PE=1 SV=1  ali follow..  10  6KQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHV. 117
46 -33.100sp|P78310|CXAR_HUMAN(removed signalp:1-19) Coxsackievirus and adenovirus receptor OS=Homo sapiens GN=CXADR PE=1 SV=1  ali follow..  27  6PEEMIEKAKGETAYLPCKFTLSPE-DQGPLDIEWDNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSGDASINVTNLQLSDIGTYQCKVKKAPGVANK-----KIHLVVLV 120
47 -32.700sp|Q08722|CD47_HUMAN(removed signalp:1-18) Leukocyte surface antigen CD47 OS=Homo sapiens GN=CD47 PE=1 SV=1  ali follow..  16  7TKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKF-KGRDIYTF-DGALNKSTVPTDFSSVSQLLKGDASLKMDKSDAVSHGNYTCEVTELTREGET-----IIELKYRV 115
48 -32.500sp|Q5ZPR3|CD276_HUMAN(removed signalp:1-28) CD276 antigen OS=Homo sapiens GN=CD276 PE=1 SV=1  ali follow..  22  6PEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDKQLVHSFAEGQD----QGSAYANRTALFQGNASLRLQRVRVADEGSFTCFVSIRDF------GSAAVSLQVAA 112
49 -32.200sp|P41217|OX2G_HUMAN(removed signalp:1-30) OX-2 membrane glycoprotein OS=Homo sapiens GN=CD200 PE=2 SV=4  ali follow..  18  5VTQDEREQLYTPASLKCSLQNAQEA----LIVTWQKKKVSPENMVTFSENHGVVIQPAYKDKINITQQNSTITFWNITLEDEGCYMCLFNTFGFGKI----SGTACLTVYV 111
50 -31.900sp|P16410|CTLA4_HUMAN(removed signalp:1-37) Cytotoxic T-lymphocyte protein 4 OS=Homo sapiens GN=CTLA4 PE=1 SV=3  ali follow..  13  5QPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVID 116
51 -31.800sp|Q96S86|HPLN3_HUMAN(removed signalp:1-17) Hyaluronan and proteoglycan link protein 3 OS=Homo sapiens GN=HAPLN3 PE=2 SV=1  ali follow..  13  37PEETLFTYQGASVILPCRYRALVSPRRVRVKWWKLSENGAPEKDVLVAIGLRHRSFGDYQGRVHLREHDVSLEIQDLRLEDYGRYRCEVIDGLEDESGLVELELRGV.... 149
52 -31.500sp|Q8TD46|MO2R1_HUMAN(removed signalp:1-23) Cell surface glycoprotein CD200 receptor 1 OS=Homo sapiens GN=CD200R1 PE=1 SV=2  ali follow..  14  22VNTSWPVKMATNAVLCCPPIALRNL--IIITWEIILRGQPSCTKAYRKETNETKETNCTDERITWVSQNSDLQIRPVAITHDGYYRCIMVTPDGNFHR-----GYHLQVLV 128
53 -31.300sp|Q8IW00|CJ072_HUMAN(removed signalp:1-23) Uncharacterized Ig-like domain-containing protein C10orf72 OS=Homo sapiens GN=C10orf72 PE=2 SV=2  ali follow..  20  7PGPVVDYLEGENATLLCHVSQKRRKD-SLLAVRWFFAHSLMVKMTKLRVVQYYGNFSRSAKRRRLRGALYRLSVLTLQPSDQGHYVCRVQE.................... 108
54 -31.200sp|O14931|NCTR3_HUMAN(removed signalp:1-18) Natural cytotoxicity triggering receptor 3 OS=Homo sapiens GN=NCR3 PE=1 SV=1  ali follow..  19  5QPPEIRTLEGSSAFLPCSFNASQGRLAIG-SVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGT----NGTRLVVEK 111
55 -30.700sp|A8MXK1|CK090_HUMAN(removed signalp:1-28) Uncharacterized protein C11orf90 OS=Homo sapiens GN=C11orf90 PE=4 SV=1  ali follow..  14  11PQATINATVKEDILLSVEYSCHGVPT-----IEWTYSSNWGTKIVEWKPGTQANISQSHKDRVCTFD-NGSIQLFSVGVRDSGYYVITVTERLGSSQF----GTIVLHV.. 110
56 -30.100sp|O75871|CEAM4_HUMAN(removed signalp:1-35) Carcinoembryonic antigen-related cell adhesion molecule 4 OS=Homo sapiens GN=CEACAM4 PE=1 SV=2  ali follow..  14  4EALPSSAAEGKDVLLLACNISETIQA-----YYWHKEGSPLIAGYITDIQA-NIPGAAYSGRETVYP-NGSLLFQNITLEDAGSYTLRTINASYDSDQ----ATGQLHV.. 105
57 -29.500sp|A8MVG2|SKIT1_HUMAN Putative selection and upkeep of intraepithelial T-cells protein 1 homolog OS=Homo sapiens GN=SKINT1 PE=5 SV=2  ali follow..  23  1.............................MEIRWFQSHTRPVYLYKDGKDLYGETISKYVERTELLKGKVTLRILNVSADDDGQYHCFFKDRNVYEES-----ITEVKVTA 83
58 -29.400sp|Q96BF3|TMIG2_HUMAN(removed signalp:1-22) Transmembrane and immunoglobulin domain-containing protein 2 OS=Homo sapiens GN=TMIGD2 PE=1 SV=2  ali follow..  16  6GPNLLQVRQGSQATLVCQVDQATAWE--RLRVKWTKDGAILCQPYITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNIT-RLFVDP 113
59 -29.300sp|Q6ZMC9|SIG15_HUMAN(removed signalp:1-19) Sialic acid-binding Ig-like lectin 15 OS=Homo sapiens GN=SIGLEC15 PE=1 SV=1  ali follow..  19  30.PPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPQVFRCAAARGSELCQTALSLHGRFRLLRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTA 147
60 -28.500sp|Q9H106|SIRPD_HUMAN(removed signalp:1-29) Signal-regulatory protein delta OS=Homo sapiens GN=SIRPD PE=2 SV=2  ali follow..  14  6TEMSQTVSTGESIILSCSVPNTLPNG----PVLWFKGTGPNRKLIYNFKQGNFPRVKEIGDTTKPGNTDFSTRIREISLADAGTYYCVKFIKGRAIKEYQSGRGTQVFVTE 112
61 -28.500sp|O95971|BY55_HUMAN(removed signalp:1-26) CD160 antigen OS=Homo sapiens GN=CD160 PE=2 SV=1  ali follow..  12  2NITSSASQEGTRLNLICTVWHKKE-EAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGE-ISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETG 110
62 -28.300sp|Q68D85|YK047_HUMAN(removed signalp:1-24) Putative Ig-like domain-containing protein DKFZp686O24166/DKFZp686I21167 OS=Homo sapiens PE=2 SV=1  ali follow..  14  8AGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSDKEVKVFEFFGD----HQEAFRPGAIVSSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQG-----TVQLEVVA 117
63 -28.200sp|Q495A1|TIGIT_HUMAN(removed signalp:1-21) T cell immunoreceptor with Ig and ITIM domains OS=Homo sapiens GN=TIGIT PE=1 SV=1  ali follow..  22  8TTGNISAEKGGSIILQCHLSSTTAQ----TQVNWEQQDQLLAIC---NADLGWHISPSFKDRVAPGP-GLGLTLQSLTVNDTGEYFCIYHTYPDGTYT----GRIFLEVLE 107
64 -27.900sp|Q9BX59|TPSNR_HUMAN(removed signalp:1-19) Tapasin-related protein OS=Homo sapiens GN=TAPBPL PE=1 SV=2  ali follow..  16  177QTQSLSFLLGSSASLDCGFSMAPGLDLISVEWRLQHKRGQLVYSWTAGQGQAVRKGATLEPAQLGMARDASLTLPGLTIQDEGTYICQITTSLYRAQQ-----IIQLNIQA 283
65 -27.500sp|Q15762|CD226_HUMAN(removed signalp:1-18) CD226 antigen OS=Homo sapiens GN=CD226 PE=1 SV=2  ali follow..  16  3VLWHTSVPFAENMSLECVYPSMGIL----TQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQS..... 109
66 -27.400sp|P40200|TACT_HUMAN T-cell surface protein tactile OS=Homo sapiens GN=CD96 PE=1 SV=2  ali follow..  13  29TEENVYATLGSDVNLTCQTQTVGFF--VQMQWSKVTNKIDLIAVYHPQYGFYCAYGRPCESLVTFTESKWTLHLRNMSCSVSGRYECMLVLYPEGIQTKIYNLLIQTHV.. 140
67 -27.400sp|Q86UW8|HPLN4_HUMAN(removed signalp:1-29) Hyaluronan and proteoglycan link protein 4 OS=Homo sapiens GN=HAPLN4 PE=2 SV=1  ali follow..  15  23APGQVVSHRGGTIVLPCRYHYEAAAGHDGVRLKWTKVVPLAFTDVFVALGPQHRAFGSYRGRAELQPGDASLVLRNVTLQDYGRYECEVTNELEDDAGMVKLDLEGV.... 134
68 -27.300sp|P40198|CEAM3_HUMAN(removed signalp:1-34) Carcinoembryonic antigen-related cell adhesion molecule 3 OS=Homo sapiens GN=CEACAM3 PE=1 SV=2  ali follow..  13  5ESMPLSVAEGKEVLLLVHNLPQHLFG-----YSWYKGERVDLIVGYVIGTQQATPGAAYSGRETIYT-NASLLIQNVTQNDIGFYTLQVIKSDLVNEE----ATGQFHV.. 106
69 -27.300sp|P80422|LV212_HUMAN Ig gamma lambda chain V-II region DOT OS=Homo sapiens PE=1 SV=1  ali follow..  16  6QPRSLSGSPGQAVTISCTGLPSVVDDDNFVSWYQQTPGRAPRLLIYDDSLRPSGVPNRFSGSKS--DTKAALTISGLQPDDEATYFCCSYV---GNYIFVFGQGTDLTVLG 111
70 -27.000sp|P01700|LV102_HUMAN Ig lambda chain V-I region HA OS=Homo sapiens PE=1 SV=1  ali follow..  12  6QPPSVSGTPGQRVTISCSGGSSNGTGNNYVYWYQQLPGTAPKLLIYRDDKRPSGVPDRFSGSKS--GTSASLAISGLRSEDEAHYHCAAWDYRLSAVVFGGGTQLTVL... 111
71 -26.800sp|Q9Y6W8|ICOS_HUMAN(removed signalp:1-19) Inducible T-cell costimulator OS=Homo sapiens GN=ICOS PE=1 SV=1  ali follow..  12  7ANYEMFIFHNGGVQILCKYPDIVQ----QFKMQLLKGGQILCLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDP-PPFKVTLTGGYLHIYE 113
72 -26.800sp|P04437|TVA2_HUMAN(removed signalp:1-21) T-cell receptor alpha chain V region CTL-L17 OS=Homo sapiens GN=TCRA PE=2 SV=1  ali follow..  10  12NSPSLSVQEGRISILNCDYT---NSMFDYFLWYKKYPAEGPTFLISISSIKDKNEDGRFTVFLNKSAKHLSLHIVPSQPGDSAVYFCAAKGAGTASKLTFGTGT-RLQVT. 117
73 -26.700sp|P01711|LV208_HUMAN Ig lambda chain V-II region VIL OS=Homo sapiens PE=1 SV=1  ali follow..  15  6QPASVSGSLGQSITISCTGTSSDVGGYNYVSWFQQHPGTAPKLIISEVRNRPSGVSDRFSGSKS--ANTASLTISGLQAEDEADYYCSSYT---SSNSVVFGGGTKLTVLG 111
74 -26.600sp|Q9GZV7|HPLN2_HUMAN(removed signalp:1-26) Hyaluronan and proteoglycan link protein 2 OS=Homo sapiens GN=HAPLN2 PE=1 SV=1  ali follow..  13  15IHEVIHSHRGATATLPCVLGT--TPPSYKVRWSKVEPGELRETLILITNGLHARGYGPLGGRARMRRLDASLVIAGVRLEDEGRYRCELINGIEDESVALTLSLEGV.... 122
75 -26.600sp|O15389|SIGL5_HUMAN(removed signalp:1-16) Sialic acid-binding Ig-like lectin 5 OS=Homo sapiens GN=SIGLEC5 PE=1 SV=1  ali follow..  15  10.QKSVTVQEGLCVLVPCSFSYPWRSWYSSLYVYWFRDGEIPYYA-VATNNPDRRVKPETQGRFRLLKKNCSLSIGDARMEDTGSYFFRVERGRDVKYSYQQN-KLNLEVTA 125

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 1 7 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Bossy-Wetzel E, Barsoum MJ, Godzik A., Schwarzenbacher R, Lipton SA. Mitochondrial fission in apoptosis, neurodegeneration and aging. Curr Opin Cell Biol. 2003 Dec;15(6):706-16. Review.