current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 5Z0M Entity 1(prereleased), from PDB1018

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .
# Score Template Links and tools%idFirst MTVRKNQATLTADEKRRFVAAVLELKRSGRYDEFVRTHNEFIMSDTDSGERTGHRSPSFLPWFRRFLLDFEQALQSVDSSVTLPYWDWSADRTVRASLWAPDFLGGTGRSTDGRVMDGPFAASTGNWPINVRVDSRTYLRRSLGGSVAELPTRAEVESVLAISAYDLPPYNSASEGFRNHLEGWRGVNLHNRVHVWVGGQMATGVSPNDPVFWLHHAYVDKLWAEWQRRHPDSAYVPTGGTPDVVDLNETMKPWNTVRPADLLDHTAYYTFDALELast
1 -75.300sp|P17643|TYRP1_HUMAN(removed signalp:1-24) 5,6-dihydroxyindole-2-carboxylic acid oxidase OS=Homo sapiens GN=TYRP1 PE=1 SV=2  ali follow..  26  103LIVRRNLLDLSKEEKNHFVRALDMAKRTSIYNYFVWTHYYSVKQESFGEVDFSHEGPAFLTWHRYHLLRLEKDMQEMEPSFSLPYWNFATGKNVCDICTDDLMGSRSNFDSTLISPNSVFSQWRVVCDSLEDYDTRNPAGNVARPMVQRLPEPQDVAQCLEVGLFDTPPFYSNSTNSFRNTYDPAVRSLHNLAHLFLNGTGGTHLSPNDPIFVLLHTFTDAVFDEWLRRYNADISTPLENAPIGHNRQYNMVPFPPVTNTEMFVTALGYTYEI.. 442
2 -71.400sp|P40126|TYRP2_HUMAN(removed signalp:1-23) L-dopachrome tautomerase OS=Homo sapiens GN=DCT PE=1 SV=1  ali follow..  23  101PVIRQNIHSLSPQEREQFLGALDLAKKRVVYDFFVWLHYYSVRDTLLGPGRPSHQGPAFVTWHRYHLLCLERDLQRLNESFALPYWNFATGRNECDVCTDQLFGAARPDDPTLISRNSRFSSWETVCDSCNGTYEGLLRRNQMGRNSMKLPTLKDIRDCLSLQKFDNPPFFQNSTFSFRNALDSQVMSLHNLVHSFLNGTNALPSAANDPIFVVLHSFTDAIFDEWMKRFNPPAAWPQELAPIGHNRMYNMVPFFPTNEELFLTSDLGYSYAIDL 436
3 -69.000sp|P14679|TYRO_HUMAN(removed signalp:1-18) Tyrosinase OS=Homo sapiens GN=TYR PE=1 SV=3  ali follow..  28  99LLVRRNIFDLSAPEKDKFFAYLTLAKHTIIYDLFVWMHYYVSMDEIWRDIDFAHEAPAFLPWHRLFLLRWEQEIQKLDENFTIPYWDWRDAEK--CDICTDEYMGGQHTNPNLLSPASFFSSWQIVCSRLCNGTPEGPLRRNPGSRTPRLPSSADVEFCLSLTQYESGSMDKAANSPLTGIADASQSSMHNALHIYMNGTMSQVGSANDPIFLLHHAFVDSIFEQWLRRHRPLQEVPEANAPIGHNRESYMVPFIPLNGDFFISSDLGYDYSYLQ 435
4 -6.850sp|P53804|TTC3_HUMAN E3 ubiquitin-protein ligase TTC3 OS=Homo sapiens GN=TTC3 PE=1 SV=2  ali   17  218.ELKTQSCMDCIEEGELMKMKGNEEFSKERFDIAIIYYTRAIEYRPENYLLYGNRALCFL------TGQFRNALGDGKRATILNTW............................................................................................................................................................................................. 298
5 -6.480sp|Q9P2D8|UNC79_HUMAN Protein unc-79 homolog OS=Homo sapiens GN=KIAA1409 PE=2 SV=3  ali   2...ERDKFYLSRSVVLELLQALKLKSPLPDTNLLLLVQAESTILSKQMIASVPGCGTAAMECVRQYINEVLDFMADMHTLTKLKSHMKTCSQPLHEDTFGGHLKVGLAQIAAMDISRGNHRDNKAVIRYLPWLYHPPSAMQQGPKEFIECVSHIRLLSWLLLGSLTHNAVCPNASSPCLPIPLDAGSHVADHLIVILIGFPEQSKTSVLHMCSLFHAFI-QLWTVYCEQSAVATNLQNQNEFSFTAILTALEFWSRVTMVEMVCLHVISLMEALQ 296
6 -6.370sp|Q5VZ89|DEN4C_HUMAN DENN domain-containing protein 4C OS=Homo sapiens GN=DENND4C PE=1 SV=2  ali   13  13FSWQKKMTQLEMEIQEAFLRFMASILKG--YRTYL-RPITEAPSNKATAADSLFDRQGFLK-YAKFYTLLEECSFVSDKDTGLAFFDDCIEK....................................................................................................................................................................................... 115
7 -6.340sp|Q9Y2H2|SAC2_HUMAN Phosphatidylinositide phosphatase SAC2 OS=Homo sapiens GN=INPP5F PE=1 SV=3  ali   10  1.....ESKEKEKLERRLLEELLKMFMDSESF-DLTNSVQRQSTGERDGRPLWQKVDDRFF-WNKYMIQDLTEIGTPDVDFWIIPMIQGFVQIEELVVNYTESSDDEKSSPETPPQESTCVDDIHPRFLVAL-------ISRRSRHRAGMRYKRRGVD-------------KNGNVANYVETEQLIHVHNHTLSFVQTRGSV--------PVFWSQVGY------RYNPRPRLDRSEKETVAYFCAHFEEQLNIYKKQVIINLVDQA......... 231
8 -6.300sp|Q9NTJ4|MA2C1_HUMAN Alpha-mannosidase 2C1 OS=Homo sapiens GN=MAN2C1 PE=1 SV=1  ali   16.RVEKFVSPLYFTDCNLRGRLFGASCPVAVLSSFLTPERLPYQEAVQRDFRPAQVGDSF--WFRVLVWRDGEPVQGLTKEGEKTSYVLTDRLGERDPRSLTLYVEVACNGLLGAGKGSMIAAPDPEKMFQLSRAELAVFHRDVHMLLVDLELLLGIAKGLGKDNQRSFQALYTANQMVNVCDPAQPETFPVAQALASRFFGQHGGESQHTIHATGHCHIDTAW-LWPFKETVRKCARS------------------VTALQLMERNPEFIFACSQ 299
9 -6.190sp|Q8NCU4|K1407_HUMAN Coiled-coil domain-containing protein KIAA1407 OS=Homo sapiens GN=KIAA1407 PE=2 SV=1  ali   10  1...KKPWKRLRMQSKQNIQVAEEHYSLFLTWFQRSQESLARKMAQADQFYSQILLKRVIQSWLQYVIDLQEEVRKFCVHFLIFRAW............................................................................................................................................................................................. 95
10 -6.150sp|Q9Y4A5|TRRAP_HUMAN Transformation/transcription domain-associated protein OS=Homo sapiens GN=TRRAP PE=1 SV=3  ali   64.LAIREWRRLPHVVSHVHTPLLQAAQQIIELQEAAQINAGLQPTNLGRNNSLHDMKTVVKTWRNRLPIVSD----------DLSHWS............................................................................................................................................................................................ 139

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 1 7 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Bossy-Wetzel E, Barsoum MJ, Godzik A., Schwarzenbacher R, Lipton SA. Mitochondrial fission in apoptosis, neurodegeneration and aging. Curr Opin Cell Biol. 2003 Dec;15(6):706-16. Review.