current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 5Z0M Entity 2(prereleased), from PDB1018

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# Score Template Links and tools%idFirst MPEITRRRALTAAAAVAATASAAVTLAAPAASAAGHHEPAAPESFDEVYKGRRIQGRPAGGGAHHHEHGGGYEVFVDGVQLHVMRNADGSWISVVSHXDPVPTPRAAARAAVDELQGAPLLPFPANLELast
1 -7.010sp|Q9H5V8|CDCP1_HUMAN(removed signalp:1-29) CUB domain-containing protein 1 OS=Homo sapiens GN=CDCP1 PE=1 SV=3  ali   10  180LTPRTVDLTVILIAAVGGGVLLLSALGLIICCVKKKKKKTNKGPAVGIYNDN-MPRQPKKFQKGRKDNDSHVYAVIEDTMVHLLQDSSGSFLPEVDTYRPFQGTMGVCPPSPPTI............. 300
2 -6.350sp|Q96Q05|TPPC9_HUMAN Trafficking protein particle complex subunit 9 OS=Homo sapiens GN=TRAPPC9 PE=1 SV=2  ali   17  13..........RLDRATDKSGDKIPLLCVPFEKKDFVGLDTDSRHYKKRCQGRKHVG-----------------------DLCLQA---GMLQDSLVHYH---MSVELLRSVNDFL-------LGAALE 97
3 -6.270sp|A6NKF7|TM88B_HUMAN Transmembrane protein 88B OS=Homo sapiens GN=TMEM88B PE=3 SV=1  ali follow..  18  1MSEQGRETEEEEGGGGASDTAPMLPRGPPDHQASALTCPGWSGPP--LLPGRLLAGL-------------HLLLPAAAFLLVLLPAAAVVYLGFLCHSRVHPAPGPRCRALFSDRGSAALIVFG.... 111
4 -6.090sp|Q9NRF2|SH2B1_HUMAN SH2B adapter protein 1 OS=Homo sapiens GN=SH2B1 PE=1 SV=3  ali   18  1..............................................................................................LEHFRVHPIPLESGGSSDVVLVS........... 23
5 -5.920sp|Q9H5V8|CDCP1_HUMAN(removed signalp:1-29) CUB domain-containing protein 1 OS=Homo sapiens GN=CDCP1 PE=1 SV=3  ali   11  30LTPRTVDLTVILIAAVGGGVLLLSALGLIICCVKKKKKKTNKGPAVGIYNDNEMPRQPKKFQKGRKDNDSHVYAVIEDTMVHLLQDSSGSFLPEVDTYRPFQGTMGVCPPSPPTICSRAPTAKLATEE 163
6 -5.910sp|O43683|BUB1_HUMAN Mitotic checkpoint serine/threonine-protein kinase BUB1 OS=Homo sapiens GN=BUB1 PE=1 SV=1  ali   12  190......HHLLGEGAFAQVYEATQGDLNDAKNKQKFVLKVQKPANPWEFYIGTQLMERLKPSMQHMFMKFYSAHLFQNGSVLVGELYSYGTLLNAINLYK------NTPEKVMPQG............. 292
7 -5.780sp|Q5QFB9|PAPAS_HUMAN(removed signalp:1-20) Protein PAPPAS OS=Homo sapiens GN=PAPPAS PE=2 SV=1  ali follow..  15  8..........................................SEFVKWYKSHKL---------------SQHCIRICG---HLCQKHLDMFLSVIGQRWPIDVFSSVFDHQVSAIGS........... 64
8 -5.760sp|O95968|SG1D1_HUMAN(removed signalp:1-21) Secretoglobin family 1D member 1 OS=Homo sapiens GN=SCGB1D1 PE=1 SV=1  ali follow..  12  13..................................................................................FLLAGKPVFKFQLAKFKAPLEAVAAKKKCVDTM............. 48
9 -5.750sp|Q9HD47|MOG1_HUMAN Ran guanine nucleotide release factor OS=Homo sapiens GN=RANGRF PE=1 SV=1  ali follow..  18  1MEPTRDCPLFGGAFSAIL-----------------------PMGAIDVSDLRPV----------------------DNQEVFCHPVTDQSLIVELLELQAHVRGEAAARYHFEDVGGVQ......... 75
10 -5.720sp|Q8TD33|SG1C1_HUMAN(removed signalp:1-23) Secretoglobin family 1C member 1 OS=Homo sapiens GN=SCGB1C1 PE=2 SV=2  ali follow..  12  15..................................................................................LVGTPEELYEGTLGKYNVNEDAKAAMKSCIDGL............. 50

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 1 7 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Bossy-Wetzel E, Barsoum MJ, Godzik A., Schwarzenbacher R, Lipton SA. Mitochondrial fission in apoptosis, neurodegeneration and aging. Curr Opin Cell Biol. 2003 Dec;15(6):706-16. Review.