current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 5Z4O Entity 1(prereleased), from PDB1018

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .
# Score Template Links and tools%idFirst GGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVDNAIDEALAGHCKEIIVTIHADNSVSVQDDGRGIPTGIHPEEGVSAAEVIMTVLHAGGKFDDNSYKVSGGLHGVGVSVVNALSQKLELVIQREGKIHRQIYEHGVPQAPLAVTGETEKTGTMVRFWPSLETFTNVTEFEYEILAKRLRELSFLNSGVSIRLRDKRDGKEDHFHYEGGLast
1 -82.100sp|Q02880|TOP2B_HUMAN DNA topoisomerase 2-beta OS=Homo sapiens GN=TOP2B PE=1 SV=3  ali   23  59TQLEHILLRPDTYIGSVEPVPGLYKIFDEILVNAADNKQRDKNMTCIKVSIESNIISIWNNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETACKKHSFKQTWMNNMMKTSEAKIKHDGEDYTCITFQPDLSKFKMEDKDIVALMTRRAYDLAGSCRGVKVMFNGKKLPVNGFRSYVD. 293
2 -81.900sp|P11388|TOP2A_HUMAN DNA topoisomerase 2-alpha OS=Homo sapiens GN=TOP2A PE=1 SV=3  ali   20  38TQLEHILLRPDTYIGSVELVPGLYKIFDEILVNAADNKQRDPKMSCIRVTIENNLISIWNNGKGIPVVEHKVEKMYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETASREYKKMFKQTWMDNMGRAGLKPFNGEDYTCITFQPDLSKFKMQDKDIVALMVRRAYDIAGSTKDVKVFLNGNKLPVKGFRSYVDM 273
3 -42.600sp|Q02880|TOP2B_HUMAN DNA topoisomerase 2-beta OS=Homo sapiens GN=TOP2B PE=1 SV=3  ali   20  1.....................................................................HKVEKVYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETACKEYKHSFKQNNMMKTSEAKIKHFDGEDYTCITFQPDLSKFKMEDKDIVALMTRRAYDLAGSCRGVKVMFNGKKLPVNGFRSYVD. 143
4 -38.000sp|P11388|TOP2A_HUMAN DNA topoisomerase 2-alpha OS=Homo sapiens GN=TOP2A PE=1 SV=3  ali   19  1..........................................................................................YDDDEKKVTGGRNGYGAKLCNIFSTKFTVETREYKKMFKQTWMDNMGRAGEMELKPNGEDYTCITFQPDLSKFKMQDKDIVALMVRRAYDIAGSTKDVKVFLNGNKLPVKGFRSYVD. 122
5 -16.500sp|Q9UHC1|MLH3_HUMAN DNA mismatch repair protein Mlh3 OS=Homo sapiens GN=MLH3 PE=1 SV=3  ali   15  2..IKCLSVEVQAKLRSGLAISSLGQCVEELALNSID---AEAKCVAVRVNMETFQVQVIDNGFGMGSD-----------EKVGNRYFTSKCQDLENPRFYGFRGEALANIADMASAVEISSKKNRTMFVKLFQSGKALKACEADVTRASAGTTVTVYPVRRKC-MDPRLEFEKVRQRIEALSLMHPSISFSLRNDVSGSM........ 197
6 -15.600sp|P54278|PMS2_HUMAN Mismatch repair endonuclease PMS2 OS=Homo sapiens GN=PMS2 PE=1 SV=2  ali   16  13KAIKPIDRKSVHQICSGQVVLSLSTAVKELVENSLDAG----ATNIDLKLKDYGLIEVSDNGCGVEEENFE---------GLTLKHHTSKFADLTQVETFGFRGEALSSLCALSDTISTCHASAKVGTRLMFDHNGKIIQKTPYP--RPRGTTVSVQ--HKEFQRNIKKEYAKMVQVLHAYCIISAGIRVSCTNQLGQGKR....... 211
7 -15.100sp|P54277|PMS1_HUMAN PMS1 protein homolog 1 OS=Homo sapiens GN=PMS1 PE=1 SV=1  ali   13  1..MKQLPAATVRLLSSSQIITSVVSVVKELIENSLDAG----ATSVDVKLENYGKIEVRDNGEGIKAV---------APVMAMKYYTSNSHEDLENLTTYGFRGEALGSICCIAE-VLITTRTAADNFSTQYVLDGSGHILSQKPSHLGQGTTVTALPVRKQFAKKCKDEIKKIQDLLMSFGILKPDLRIVFVHNK............ 194
8 -14.500sp|Q86VD1|MORC1_HUMAN MORC family CW-type zinc finger protein 1 OS=Homo sapiens GN=MORC1 PE=2 SV=2  ali   16  6PALQRAQLRLDFIHANSTTHSFLFGALAELLDNARDAG----AERLDVFSVDNEKLCFLDDGCGM-----------SPEEASDIIYFGRSKKRLSTLKFIGQYGNGLKSGSRIGKDFILFTKKEETMTCVFFS........................................................................... 130
9 -14.100sp|O95744|PM2L2_HUMAN Putative postmeiotic segregation increased 2-like protein 2 OS=Homo sapiens GN=PMS2L2 PE=5 SV=1  ali follow..  13  75KAIKPIDRKSVHQICSGPVVLSLSTAVKKIVGNSLDAG----ATNIDLKLKDYGLIEVSGNGCGVEEENFEGLSLSALKHHTSKI---REFADLTRVETFGFQGKALSSLCALSD-VTISTCHVSAKVGTRLVFDHDGKIIKKTPYPHPRGTTVSVK--HKEFQRNIKKKRACFPFAFCRDCQFLEGSPA.................. 265
10 -14.000sp|Q9Y6X9|MORC2_HUMAN MORC family CW-type zinc finger protein 2 OS=Homo sapiens GN=MORC2 PE=1 SV=2  ali   15  7SSLNRAQLTFEYLHTNSTTHEFLFGALAELVDNARDADATRIDIYAERREDLRGGLCFLDDGAGM-----------DPSDAASVIQFGKSAKRTPESTQIGQYGNGLKSGSRIGKDFILFTKKEDTM................................................................................. 125
11 -14.000sp|P40692|MLH1_HUMAN DNA mismatch repair protein Mlh1 OS=Homo sapiens GN=MLH1 PE=1 SV=1  ali   17  23....EVIQRPA-------------NAIKEMIENCLDAK----STSIQVIVKEGGLIQIQDNGTGIRKEDLD---------IVCERFTTSKFEDLASISTYGFRGEALASISHVAHTITTKTADGKCAYRASYSDGKLKAPPKPCA--GNQGTQITVEATRRKALKNPSEEYGKILEVVGRYSVHNAGISFSVKKQGETVADVRTLPNA 210
12 -13.700sp|Q8TE76|MORC4_HUMAN MORC family CW-type zinc finger protein 4 OS=Homo sapiens GN=MORC4 PE=1 SV=2  ali   17  28FGIRLSTMSPRYLQSNSSSHTRPFSAIAELLDNAVDPDVSARTVFIDVEEVKNKSLTFTDDGCGM-----------TPHKLHRMLSFGFTDKVIKKSQCPGVFGNGFKSGSRLGKDALVFTKNGGTLTVGLLS........................................................................... 152
13 -13.100sp|Q14149|MORC3_HUMAN MORC family CW-type zinc finger protein 3 OS=Homo sapiens GN=MORC3 PE=1 SV=3  ali   18  7RGIRLSALCPKFLHTNSTSHTWPFSAVAELIDNAYDPDVNAKQIWIDKTVINDHCLTFTDNGNGM-----------TSDKLHKMLSFGFSDKVTMNGHVPGLYGNGFKSGSRLGKDAIVFTKNGESM................................................................................. 125
14 -12.600sp|P03950|ANGI_HUMAN(removed signalp:1-24) Angiogenin OS=Homo sapiens GN=ANG PE=1 SV=1  ali follow..  23  12.......................QHYDAKPQGRDDRRGLTSPCKDINTFIHGRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLPVHLDQSIFR..................................................................................... 121
15 -12.600sp|Q13400|PM2L8_HUMAN Postmeiotic segregation increased 2-like protein 8 OS=Homo sapiens GN=PMS2L8 PE=3 SV=1  ali follow..  12  158EPAKAIKPIDRKSVHQICSGPVVPSLVKELVENSLDAG----ATNVDLKLKDYGLIEVSGNGCGVEEENFE---------GFTLKHHTCKFADLTQVETFGFRGEALSSLCALSD-VTISTCRVSAKVGTRLVFDHYGKIIQKTPYPRPRGMTVSVKPVHHKEFQRNIKKKRACFPFAFCRDCQFPEASPAMLPVQPVELTPRSTPPH 366
16 -12.500sp|A6NHR9|SMHD1_HUMAN Structural maintenance of chromosomes flexible hinge domain-containing protein 1 OS=Homo sapiens GN=SMCHD1 PE=1 SV=2  ali   17  134...............ASEGQNPLPFALAELIDNSLSATSRNIGVRRIQIKLGKPAVAVIDNGRGM-------TSKQLNNWAVYRLSKFTRQGDFESDHSGSYFGVGGKQAVFVGQSARMISKPADS.................................................................................. 259
17 -11.000sp|Q15118|PDK1_HUMAN [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 1, mitochondrial OS=Homo sapiens GN=PDK1 PE=1 SV=1  ali follow..  22  273......................LYHMVFELFKNAMRATMEHHANRIQVHVTLGNTVKMSDRGGGVPLR--------KIDRLFNYMYSRPRVETSRAVPLAGF-GYGLPISRLYAQYF........................................................................................... 369
18 -10.700sp|P0C857|PM2LC_HUMAN Putative postmeiotic segregation increased 2-like protein 12 OS=Homo sapiens GN=PMS2L12 PE=5 SV=1  ali follow..  14  6..........................................RGPQDLKLKDYGLIEVSDNGCGVEEENFE---------GLTLKHHTCKFADLTEVETFGFQGEALSSLCALSD-VTISTCHASAKVGTRLVFDHYGKIIQKTPYPHPRGMTVSVKPVRHKEFQRNIKKGSTSADFINRYRRKQRHVEDFP................ 156
19 -10.700sp|Q58FF6|H90B4_HUMAN Putative heat shock protein HSP 90-beta 4 OS=Homo sapiens GN=HSP90AB4P PE=5 SV=1  ali follow..  14  15.........................FLQELISNASDPSKLDGGKELKIDIIPNCILTLVNTGIGM-------TKADLINNLGAIAKSGTEFQSCAEISMIGQFGVGFYSAYLVAEKVAITKHNDEEQYSWVSSAGSSFTLHVDHGEPIDRDTKVILHLKEDQTEYLEERWVKEVVKKHPQFI----GCLIAVYLEKEPEKE....... 199
20 -10.400sp|A4D2B8|PM2L1_HUMAN Putative postmeiotic segregation increased 2-like protein 1 OS=Homo sapiens GN=PMS2L1 PE=5 SV=1  ali follow..  13  213KAIKPIDRKSVHQICSGPVVPSLSTAVKELVENSLDAG----ATNIDLKLKDYGLIEVSGNGCGVEEENFE---------GLTLKHHTSKFADLPQVETFGFRGEALSSLCALSD-VTISTCHVSAKVGTRLVFDHYGKIIQKTPYPHPRGMTVSVKPVHHKEFQRNIKKKRACFPFAFCRDCQFPEASPAMLPVQPAELTPRSTPPH 417
21 -10.400sp|O95746|PM2LG_HUMAN Postmeiotic segregation increased 2-like protein 16 OS=Homo sapiens GN=PMS2L16 PE=2 SV=1  ali follow..  15  12KAIKPIDRKSVHQICSGPVVLSLSTAVKKIVGNSLDAG----ATNIDLKLKDYGLIEVSGNGCGVEEE............................................................................................................................................ 77
22 -10.200sp|Q13670|PM2LB_HUMAN Putative postmeiotic segregation increased 2-like protein 11 OS=Homo sapiens GN=PMS2L11 PE=5 SV=1  ali follow..  12  159KAIKPIDRKSVHQICSGPVVLSLSTAVKELVENSLDAG----ATNIDLKLKDYGLIEVSGNGCGV-----EEENFEGLMMSPFL-PATSRRRLGL-----DWCLITMGKSSRRPPTPTPEGPQSA................................................................................... 270
23 -10.200sp|Q16654|PDK4_HUMAN [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 4, mitochondrial OS=Homo sapiens GN=PDK4 PE=1 SV=1  ali follow..  18  248......................LHHMLFELFKNAMRATVEHQENQIEVIVVLGKTIKISDRGGGVPLR--------IIDRLFSYTYSTAVMDNSRNAPLAGF-GYGLPISRLYAKYF........................................................................................... 344
24 -9.750sp|Q15120|PDK3_HUMAN [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 3, mitochondrial OS=Homo sapiens GN=PDK3 PE=1 SV=1  ali follow..  14  241......................LFHMLFELFKNSMRATVELYEDRVKTLVTLGKSIKISDLGGGVPLR--------KIDRLFNYMYSTAP-EPTRAAPLAGF-GYGLPISRLYARYF........................................................................................... 338
25 -9.680sp|P08238|HS90B_HUMAN Heat shock protein HSP 90-beta OS=Homo sapiens GN=HSP90AB1 PE=1 SV=4  ali   17  39.........................FLRELISNASDPSKLDSGKELKIDIIPNRTLTLVDTGIGM-------TKADLINNLGTIAKSGTKLQAGADISMIGQFGVGFYSAYLVAEKVVVITKHDDEQYAWESSAGGSFTVRADHGEPIGRGTKVILHLKEDQTEYLEERRVKEVVKKHSQFI----GYPITLYLEKEREKE....... 224
26 -9.670sp|Q12931|TRAP1_HUMAN(removed signalp:1-25) Heat shock protein 75 kDa, mitochondrial OS=Homo sapiens GN=TRAP1 PE=1 SV=3  ali   14  87.........................FIRELISNASDDGQALPEMEIHLQTNAEGTITIQDTGIGM-------TQEELVSNLGTIARSGSKAFLDALQNQAGQFGVGFYSAFMVADRVEVYSRSAAPSLGYQWLSDGSGVFEIAEASGVRTGTKIIIHLKSDCKEFSSEARVRDVVTKYSNFV----SFPLYLNGRRMNTLQ....... 271
27 -9.630sp|P14625|ENPL_HUMAN(removed signalp:1-21) Endoplasmin OS=Homo sapiens GN=HSP90B1 PE=1 SV=1  ali   16  79.........................FLRELISNASDENALSGNEELTVKIKCDNLLHVTDTGVGMTREELVKNAKSGTSEFLNKMTEAQEDGQSTSEL--GQFGVGFYSAFLVADKVIVTSKHNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFI----NFPIYVWSSKTETVE....... 269
28 -9.630sp|P07900|HS90A_HUMAN Heat shock protein HSP 90-alpha OS=Homo sapiens GN=HSP90AA1 PE=1 SV=5  ali   15  44.........................FLRELISNSSDPSKLDSGKELHINLIPNRTLTIVDTGIGM-------TKADLINNLGTIAKSGTKLQAGADISMIGQFGVGFYSAYLVAEKVTVITKHDDEQYAWESSAGGSFTVRTDTGEPMGRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFI----GYPITLFVEKERDKE....... 229
29 -9.590sp|Q14568|HS902_HUMAN Putative heat shock protein HSP 90-alpha A2 OS=Homo sapiens GN=HSP90AA2 PE=1 SV=2  ali follow..  14  25....EIAQLMSLIINTFYSNKEIF--LRELISNSSDPSKLDSGKELHINLIPNQTLTIVDTGIGM-------TKADLINNLGTIAKSGTKAFMEALQAGAGQFGVSFYSAYLVAEKVTVITKHNDEQYAWESSAGGSFTVRTDTGERMGRGTKVILHLKEDQTEYLEEQRIKEIVKKHSQLI----GYPITLFVEKECDKE....... 229
30 -9.490sp|A6NHR9|SMHD1_HUMAN Structural maintenance of chromosomes flexible hinge domain-containing protein 1 OS=Homo sapiens GN=SMCHD1 PE=1 SV=2  ali   10  1................................NSLSATSRNIGVRRIQIKLGKPAVAVIDNGRGMT-----------SKQLNNWAVYRLSKFTRQGDFESSYFGVGGKQAVFVGQSARMISKPADSQ-HITNDDERFLHHLIIEEKEKDSFTAVVITGVQPEHIQYLKNYFHLWTRQLAHI........................... 199

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 1 7 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Bossy-Wetzel E, Barsoum MJ, Godzik A., Schwarzenbacher R, Lipton SA. Mitochondrial fission in apoptosis, neurodegeneration and aging. Curr Opin Cell Biol. 2003 Dec;15(6):706-16. Review.