current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 5Z0B Entity 1(prereleased), from PDB1018

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .
# Score Template Links and tools%idFirst DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQXPFEDHVKLVNEVTEFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVDETYVPKEFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVEKCCKADDKETCFAEEGKKLVAASQAALGLLast
1 -3.850PB018258 Q7MT99_PORGI/1-157 PB018258; Pfam-B_18258;  ali follow..  1.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................MSETKERLCIYADFPYEFAVCAPRTDPKREQCLRASALARGLQKITVINPLIPTSEQGCKAFADNTPV---LFAHGITHLYDELPHHAVQSLKHRLLTYFGK--RIYRKERYITIQEQDYIRDSFVRAGF 134
2 -2.780PB004588 Q64QH1_BACFR/1-389 PB004588; Pfam-B_4588;  ali follow..  20  1................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................MCTTNAVNEKISY-TINMDTQKKHNLSGTIILVSCF-----LAGACDNSDRIETETQANGVLLN......... 60
3 -2.700HGC00711 gi|162743779|dbj|BAAZ01020484.1|1.0 TMP00907;  ali follow..  12  28...........DERGAGTVLVVGVIAV-----------LLAAALGVSGLIQAQAAAGRSRAAAD------LAALGGATALSSIVAPGDPCARANGAEVTTC.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 106
4 -2.480HGC00672 gi|162843654|dbj|BABA01001055.1|4.0 TMP00845;  ali follow..  20  107................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LFELSEQGGEYRFEEVKPTGAGIKKLSKECCQTLSTFILF................. 150
5 -2.380PB001572 gi|163816107|ref|ZP_02207475.1| hypothetical protein COPEUT_02291 [Coprococcus eutactus ATCC 27759]gi|158448527|gb|EDP25522.1| hypothetical protein COPEUT_02291 [Coprococcus eutactus ATCC 27759]  ali follow..  12  135.......C-AYASFHEKFIKGHVTLIGCPKLDSVDYEKLTEIIRRIVRMEVPCCGG--LEMAAKKALQDSGKFIPWQVATISIDGRI.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 222
6 -2.340HGC00947 gi|162844524|dbj|BABA01000185.1|4.0 TMP01280;  ali follow..  22.............................................................................................................................................................................................................................................................................................................................................................................................................................................................SSCSE-------EEDCSMNARPMMQCYLYKIDGETERVVNDTLDSLTITAFGTDSIILNNQKRVHGLSLPLRYTADST---VLVFHYSKDVKIKKDTIVIRQKNTPYFLSMDC-YSRHLLDSIYIQTAEVSIYGTENLKL 162
7 -2.330HGC00593 gi|162858151|dbj|BABB01011554.1|1.0 TMP00709;  ali follow..  3..........MTDNNDDVLVKKFFSENRIDVPDDGFSRLPDRTRRISRLWTAVC................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 51
8 -2.300PB001030 Q6D4H5_ERWCT/1-146 PB001030; Pfam-B_1030;  ali follow..  12  28.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................EKRHPETDASTQYNDLFSYAIKR------------------LERCCKH--PIHCYQPARREAIKAIMR.... 84
9 -2.180PB027498 Q7MTK6_PORGI/1-146 PB027498; Pfam-B_27498;  ali follow..  12  17..................VAALTEIRHSHKRRAAEAKGESLPEEPVRVVPPGCCGMHI---------------TCEKDSLLTAVSKSIVYYDDEELDRYA-----GVLPEEYNTEAVEEFEEILSTLQEEEVPSWIRSLQMRQIQMPISIKEQALFIVSE......................................................................................................................................................................................................................................................................................................................................................................................................................................... 138
10 -2.050PB064361 Q64PJ4_BACFR/1-580 PB064361; Pfam-B_64361;  ali follow..  12  1....................................................................................................................................................................................................................................................................................................................................................MKIERLFIYCLLAGTSLLASCNSEDMTDNPVETLSE-----------------------------MYPLTFTAMQGEVVATPQTRVSDYDDTDGKHKSKWDGGEVIGVKIGTDGAVGSYTLDSDGKPTTSTSNIPAYWQSTASQT--VYGWYPNTADISLTGQDNTGNKFPYVLKGVSSKQYSYKENVQLNLEHQLVKF----RVKLNGDVPNLSDAKVFFYGYPTCKNEYGTVIPQGDKTYLAT 211

FFAS is supported by the NIH grant R01-GM087218-01
1 3 2 7 5 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Doctor KS, Reed JC, Godzik A., Bourne PE. The apoptosis database. Cell Death Differ. 2003 Jun;10(6):621-33. Review.