current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 5Z0B Entity 1(prereleased), from PDB1018

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .
# Score Template Links and tools%idFirst DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQXPFEDHVKLVNEVTEFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVDETYVPKEFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVEKCCKADDKETCFAEEGKKLVAASQAALGLLast
1 -9.110sp|Q7RTU9|STRC_HUMAN Stereocilin OS=Homo sapiens GN=STRC PE=2 SV=1  ali   11  1...................................................ALCENHLGPAPPYSISNFSIHLLCQKPATPQPHPSTTAICQTAVWYAVSCHDQFPDE----------FLDAICSNLS-------------------------FSALSGSNRRLVKRLCAGLLPPPTSCPEGLPPVPLTPDIF----WGCFLENETLAERLCGEASLQAVPPSNQAWVQHVCQGPTPDVTASPPCHIGPCGERCPDGGSFLVMVCANDTMYEVLVPF-CRISRGGNDTCFLE..................................................................................................................................................................................................................................................................................................... 222
2 -9.110sp|A6NGW2|STRCL_HUMAN Putative stereocilin-like protein OS=Homo sapiens GN=STRCP1 PE=5 SV=1  ali   11  1...................................................ALCENHLGPAPPYSISNFSIHLLCQKPATPQPHPSTTAICQTAVWYAVSCHDQFPDE----------FLDAICSNLS-------------------------FSALSGSNRRLVKRLCAGLLPPPTSCPEGLPPVPLTPDIF----WGCFLENETLAERLCGEASLQAVPPSNQAWVQHVCQGPTPDVTASPPCHIGPCGERCPDGGSFLVMVCANDTMYEVLVPF-CRISRGGNDTCFLE..................................................................................................................................................................................................................................................................................................... 222
3 -7.540sp|Q6ZRI0|OTOG_HUMAN Otogelin OS=Homo sapiens GN=OTOG PE=2 SV=3  ali   11  5........................................ALGETWNSSLSGCCQAPDTIVPVDLGCPSPRPESCLRFGEVALLLPTKDCC-----LGTVCVCNQTLCEGLAPT---------CRPGHRLLTHFQE-----------------------------DSCCPECDPDLCEAELVPSCRQDQILITGRLGDSCC-----------TSYFCACGDCPDSIPECQEGEALTVHRNTTELCCPLYQCVCENFRCPQVQCGLGTALVEVWSPDRCCPYKSCECDCDTIPVPRCHLWEKSQLDEEFMHSVEN-------------------------------------------VCGCAKVKAPVCLSRELGVMQPGQTVVELSADGVCHTS----------------------------------------RCTTVLDPLTNFYQINTTSVLCDIHCEANQEYEHPRDLAACCGS---RNVSCLFTFPNGTTSLFLPGASWIADCARHHCSSTPLG-------VLVRSPISCPPLNETECAKVGGSVVPSLEGC........................... 389
4 -6.430sp|Q5T7M9|FA69A_HUMAN Protein FAM69A OS=Homo sapiens GN=FAM69A PE=2 SV=1  ali   14  1..................................................................................................................................................................................................................................................................................................................................................................................................................................................TELCRGKDCKKIICDKYKTGVIDGPACNS------------LCVTETLYFGKCLSTKPNNQMYL------GIWDNLPGVVKCQMEQALHLDFGTELEPRKEIVLFDKPTRGTTVQKFKEMVYSLFKAK....................... 110
5 -6.420sp|Q5VUD6|FA69B_HUMAN Protein FAM69B OS=Homo sapiens GN=FAM69B PE=2 SV=3  ali   18  3...............................................................................................................................................................................................................................................................................................................................................................................................................................................SSYSERCRGHVCQVVICDQYRKGIISGSVCQD------------LCELHMVEWRTCLSVAP............................................................................................. 51
6 -5.740sp|Q6NUI2|GPAT2_HUMAN Glycerol-3-phosphate acyltransferase 2, mitochondrial OS=Homo sapiens GN=GPAT2 PE=2 SV=2  ali   23  6.........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................GMKLEAVTPFLGKYRPFVGRCCQT-----CTPKSWESLFHRSITDLGF 48
7 -5.740tr|E9PE95|E9PE95_HUMAN Uncharacterized protein OS=Homo sapiens GN=GPAT2 PE=4 SV=1  ali   23  6.........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................GMKLEAVTPFLGKYRPFVGRCCQT-----CTPKSWESLFHRSITDLGF 48
8 -5.630sp|Q9NSA0|S22AB_HUMAN Solute carrier family 22 member 11 OS=Homo sapiens GN=SLC22A11 PE=1 SV=1  ali   12  4....SKLLEQAGGVGL--FQTLQVLTFILPCLMIPSQMLLEN---SAAIPGHRCWTHMLDNGSAVSTNMTPKALLTISIPPGPNQGPHQC-SWSEADTEPCVDGWVYDRSVFTSTIVAKWDLVCS............................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 137
9 -5.240sp|Q9NUA8|ZBT40_HUMAN Zinc finger and BTB domain-containing protein 40 OS=Homo sapiens GN=ZBTB40 PE=1 SV=4  ali   13  25............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LEMCSEIKGPQKEMIVKCFEGEGGHSAFQRILGKVREESLDVQTV 69
10 -5.190sp|Q6B9Z1|IGFL4_HUMAN Insulin growth factor-like family member 4 OS=Homo sapiens GN=IGFL4 PE=2 SV=1  ali   31....................................................................................................................................................................................................................................QPAPRCGEWTYNPLEQCCDDGVILDLNQ-----TRLCGSSCTFWPCFQHCCLESLGSQNQTVVRFK................................................................................................................................................................................................................................................................................................... 91

FFAS is supported by the NIH grant R01-GM087218-01
1 3 2 7 5 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Doctor KS, Reed JC, Godzik A., Bourne PE. The apoptosis database. Cell Death Differ. 2003 Jun;10(6):621-33. Review.