current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 11as_A mol:protein length:330 ASPARAGINE SYNTHETASE, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330
# Score Template Links and tools%idFirst MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDEDRLSPLHSVYVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATEAAVSEEFGLAPFLPDQIHFVHSQELLSRYPDLDAKGRERAIAKDLGAVFLVGIGGKLSDGHRHDVRAPDYDDWSTPSELGHAGLNGDILVWNPVLEDAFELSSMGIRVDADTLKHQLALTGDEDRLELEWHQALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQAGVWPAAVRESVPSLLLast
1 -136.00011as_A mol:protein length:330 ASPARAGINE SYNTHETASE  ali model  100  1MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDEDRLSPLHSVYVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATEAAVSEEFGLAPFLPDQIHFVHSQELLSRYPDLDAKGRERAIAKDLGAVFLVGIGGKLSDGHRHDVRAPDYDDWSTPSELGHAGLNGDILVWNPVLEDAFELSSMGIRVDADTLKHQLALTGDEDRLELEWHQALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQAGVWPAAVRESVPSLL 330
2 -113.0004lns_A mol:protein length:351 Asparagine synthetase a  ali model follow..  59  7..SSYVLLQEQILTVKRSFSEALEKELNLVEVRAPILFRVGDGTQDNLSGFEKAVQVPVKAIPNASFEVVHSLAKWKRRTLANYKFAPGHGLYTHMTALRV-DDVLDNIHSVVVDQWDWEMVMKDDQRNLAFLKEVVCKVYAAIRKTELAVCEKYKQKPILPETIQFVHAEHLLLAYPNLTAKEREREIAREYGAVFLIGIGAVLSSGDRHDARAPDYDDWTSNSLSSLKGLNGDILLYNPTLDDSLEVSSMGIRVNAEALRHQISLTGDDSLLKSEWHQQLLNGEFPQTVGGGIGQSRMVMFMLRKKHIGEVQCSVWPEEIRKKHNLL. 351
3 -69.8001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  11  8.....SREISPTLDIQTKILEYMTDFFGFKWLLPVIISPITDPLWPD--PAGEGMEPAEVEIYGVKMRLTHSMILHKQLAIAM----GLKKIFVLSPNIRLESQKDDGRHAYEFTQLDFEVERAKMEDIMRLIERLVYGLFRKAEEWTGREFPKT-------KRFEVFEYSEVLEEFGSDEKASQEME-----EPFWIINIPREFYDRE---------------------VDGFWRNYDLILPYGYGEVASGGEREWEYEKIVAKIRKAGLNEDSFRPYLEIAKAGLKPSAGAGIGVERLVRFIVGAKHIAEV--QPFPRIPGIPA.... 292
4 -68.2003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein  ali model follow..  13  4..VEIIRDIYKAIDIQTKILDYMTKFFGFKWLLPIMLSPITDPLWPD--PAGEGIRPAEVDVYGVRMRLTHSMILHKQLAIAM----GLEKIFVLSPNIRLESRKDDGRHSYEFTQLDFEIEGAKMKDVMRLIEELIYGLFRKAEEWTGREFP-------RARHFKVYDYKDILEEFG-----SDEKASMEMEEPFWIVNIPREFYDREEN---------------------GVWKNYDLILPYGYGEVSSGGEREWEYEKIVAKIRAAGLKEDSFRPYLEIARAGLKPSAGAGIGVERLVRFIVGAKHIAEV--QPFPRVPGIPAV... 293
5 -66.4001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  16  129....RRPEVMAIFKIRSSVFKAVRDFFGFIEIHTPKIIATA---------TEGGTELFPMKYFEEDAFLAESPQLYKEIMM----ASGLDRVYEIAPIFR-AEEHNTTRHLNEAWSIDSEMAFEDEEEVMSFLERLVAHAINYVREHNAKELDILNFEEEPKLPFPRVSYDKALEILGDLGKEIPWGEDIDTEGERLLGKYMME-----NENAPLYFLYQYPSEAKPFYIMKYDNICRAFDLEYRGVEISSGGQREHRHDILVEQIKEKGLNPESFEFYLKAFRYGMPPHGGFGLGAERLIKQMLDLPNIREV--ILFPRDRRRLTP... 438
6 -63.5001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  14  170..IDLRVTNQAIFRIQAGVCELFREYLKFTEVHTPKLLGAP---------SEGGSSVFEVTYFKGKAYLAQSPQFNKQQLI----VADFERVYEIGPVFR-AENSNTHRHMTEFTGLDMEMAFEEYHEVLDTLSELFVFIFSELPKRFAHEIELVRKQYPVEGKMVRLTYKEGIEMLRAAGKEGDFEDLSTENEKFLGKLVRDKYDTD------FYILDKFPLEIRPFYTMPDPAYSNSYDFFMRGEEILSGAQRIHDHALLQERMKAHGLSPEDLKDYCDGFSYGCPPHAGGGIGLERVVMFYLDLKNIRRA--SLFPRDPKRLRP... 490
7 -63.3001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  16  117....RGEKARAPLKVQAALVRGFRRYLDFTEIFTPKVVRA---------GAEGGSGLFGVDYFEKRAYLAQSPQLYKQIMVGVF-----ERVYEVAPVWR-MEEHHTSRHLNEYLSLDVEMGFADEEDLMRLEEALLAEMLEEALNTAGDEIRLLGATPSFPQDIPRLTHAEAKRILKEELGYPVGQDLSEEAERLLGEYAKERWGSD------WLFVTRYPRSVRPFYTYPEDGTTRSFDLLFRGLEITSGGQRIHRYEELLESLKAKGMDPEAFHGYLEVFKYGMPPHGGFAIGAERLTQKLLGLPNVRYA--RAFPRDRHRLTP... 422
8 -63.2004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  16  199..IDLRSTSQAVFRLQSGICHLFRETLGFVEIQTPKIISAA---------SEGGANVFTVSYFKNNAYLAQSPQLYKQMCI----CADFEKVFSIGPVFR-AEDSNTHRHLTEFVGLDIEMAFNYYHEVMEEIADTMVQIFKGLQERFQTEIQTVNKQFKFLEPTLRLEYCEALAMLREAGVEMGD---EDDLSTPNEKLLGHLVKEKY--DTDFYILDKYPLAVRPFYTMPDPRQSNSYDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLERVTMLFLGLHNVRQT--SMFPRDPKRLTP... 515
9 -63.0001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  14  126....RRQEMQAVIKIQSLALKAFRETLGFIEIFTPKIIASA---------TEGGAQLFPVIYFGKEAFLAQSPQLYKELMAGVV-----ERVFEVAPAWR-AEESDTPFHLAEFISMDVEMAFADYNDVMQLLEKILHNIVKTIKEEGKEELKILNYEPEVKIPIKRLKYTEAIEILRSKGYNKFGDDIGTPELRILNEELKED----------LYFIVDWPSDARPFYTKSKSELSESFDLIYKFLEIVSGSTRNHKREVLEEALKKKGLKPESFEFFLKWFDYGMPPHAGFGMGLARLMVMLTGIQSVKEI--VPFPRDKKRLTP... 429
10 -62.4003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  10  148....RSEHTQQVLQLRSEIQWYFRKYYHFTEIQPPTIVKTQ---------CEGGSTLFKLQYFNEPAYLTQSSQLYLESVIASL-----GKSFCMLSSYR-AEQSRTVRHLAEYLHLEAELPFISFEDLLNHLEDLVCTVIDNVMAVHGDKIRKMNPHKLPTRPFKRMTYADAIKYCNDHGILNKDKPFEYGEDISEKPERQMT-----DEIGCPIFMIHFPSKMKAFYMSKVPGLTESVDLLMPGVEIVGGSMRIWNYDELMGAYKANGLNPDPYYWYTQQRKYGSCPHGGYGLGVERLVMWLLGEDHIRKV--CLYPRYLERCEP... 456
11 -62.0001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  15  127....RTPKASAIMKVKETLIMAAREWLGWHEVFPPILVTG---------AVEGGATLFKLKYFDKYAYLSQSAQLYLEAAIFGL-----EKVWSLTPSFR-AEKSRTRRHLTEFWHLELEAAWMDLWDIMKVEEELVSYMVQRTLELRKKEIEDLTTLKNTEPPFPRISYDEAIDILQSKGVNVEWGDDLGADEERVLTE----------EFDRPFFVYGYPKHIKAFYMKEDPNKVLASDMLEGYGEIIGGSQREDDYDKLLNRILEEGMDPKDYEWYLDLRRYGSVPHSGFGLGVERLVAWVLKLDHIRWA--ALFPRTPARLYP... 434
12 -60.6003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  14  233..LDLRVTNIAIFRIQSACCGLFREFLKFVEIHTPKLIGCS---------SEGGSNIFEVKYFDRKAYLAQSPQLYKQMAI----MGDFRKVFEVGPVFR-AENSNTRRHLTEFEGLDIEMEIVNYHECIDVMEKLFTFIFDEIPKRFPDELKVIPFEDLIYRPFLRLTYKEAIEMLRASGETIGD---YDDFTTPQEVKLGELIKAKY--NTDFYILDKFPAAIRPFYTMPDIDYSNSYDVFVRGQEITSGAQRIHDPEFLMKRCIEKGVDPATLKDYIESFRFGSWPHAGCGIGLERITMLYLGIPNIRKV--TLFPRDPIRLNP... 548
13 -60.4005xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  13  156....RGENMSKILKARSMVTRCFRDHFGYYEVTPPTLVQTQ---------VEGGATLFKLDYFGEEAFLTQSSQLYLETCLPAL-----GDVFCIAQSYR-AEQSRTRRHLAEYTHVEAECPFLTFDDLLNRLEDLVCDVVDRILKSPAGSIVHEPNFQPPKRPFKRMNYSDAIVWLKEHDVKK-EDGTFYEFGEDIPEAPERLMTDTI---NEPILLCRFPVEIKSFYMQRCPELTESVDVLMNVGEIVGGSMRIFDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDV--CLYPRFVQRCTP... 466
14 -59.7002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  12  126....RGENAAALLRLRAAATRAMREHFGYVEVAPPTLVQTQ---------VEGGSTLFNLDYFGEQSFLTQSSQLYLETCIPTL-----GDVFCIAQSYR-AEKSRTRRHLAEYAHVEAECPFITLDDLMEKIEELVCDTVDRLLADEEAKKLLEHINPKPERPFLRMEYKDAIKWLQEHNVENEFGN-TFTYGEDIAEAAERFMTD---TINKPILLNRFPSEIKAFYMQRDAKLTESVDLLMPGVEIVGGSMRIWKFDELSKAFKNVEIDPKPYYWYLDQRLYGTCPHGGYGLGLERFICWLTNTNHIRDV--CLYPRFVGRCVP... 437
15 -45.6001efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model follow..  14  140MQENLRLRHRVIKAIWDFLDRE-----GFVQVETPFLTKSTPEGARDFL-------VPYRHEPGLFYALPQSPQLFKQMLM----VAGLDRYFQIARCFR-DEDLRADRQ--DFTQLDLEMSFVEVEDVLELNERLMAHVFREALAELEEVAKRHKAQGLAWARVEEGGFSGGVAKFLEPVREALLQATEARPGDTLLFVAGPRLEWDEEEEAWTYMHHPFTSPHPEDLPLLEKDRALAYDLVLNGVEVGGGSIRIHDPRLQARVFRLEEEQREKFGFFLEALEYGAPPHGGIAWGLDRLLALMTGSPSIREVIA--FPKNKEGKDP... 557
16 -44.8004rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  14  133PGNALRLRSKVNAAARSVLAEH-----DFVEIETPTLTRSTPEGARDFL-------VPARLQPGSFYALPQSPQLFKQLLM----VAGMERYYQIARCYR-DEDFRADRQ--EFTQLDMEMSFVEADDVIAISEQVLKAVWATIGYD-------------LPLPLPRISYEEAMRRFGSDKPDLRFGIELVECTEYFKDTTFRVFQAPVGSGAWTAMHHAFTAPKPDSVDTFDSDLSDAYDIVCNGNEIGGGSIRIHRRDIQERVFAMHDEAQEKFGFLLDAFSYGAPPHGGIAFGWDRITALLAGVDSIREVIA--FPKSGG....... 559
17 -44.4003g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  13  13SIPNLLKRAAIMAEIRRFFADR-----GVLEVETPCMSQATVT--DIHLFPFETRFVGPGHSQGINLYLMTSPEYHMKRLL----AAGCGPVFQLCRSFRNEE--MGRHHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCQPAESLSYQQAF--QRHLEIDPLSADKTQLREAAAKLDLSNIAD--TEEDRDTLLQLLFTMGVEPHIGKEKPTFIYHFPASQASLAQISTEDVAERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAA-QNLLDALAAGLPDCSGVALGVDRLVMLALGAESLADVI--AFT........... 322
18 -44.3005w25_A mol:protein length:616 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  14  152PAAAIRLRSRVNAAARAVLARH-----DFVEIETPTITRSTPEGARDFL-------VPARLHPGSFYALPQSPQLFKQLLM----VAGMERYYQIARCYR-DEDFRADRQ--EFTQLDMEMSFVDAEDIIAISEEVLTELWALIGYR-------------IPTPIPRIGYAEAMRRFGTDKPDLRFGLELVECTDFFADEATAAGEVAVGSGAWTAVHHAFTAPKPEWEDRIESDLADAYDIVCNGHEIGGGSVRIHRRDIQERVFAVKAEAEEKFGFLLEAFMFGAPPHGGIAFGWDRTTALLAGMDSIREVIA--FPKTGG....... 578
19 -43.9003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  13  26SIPNLLKRAAIMAEIRRFFADR-----GVLEVETPCMSQATV--TDIHLVPFETRFVGPGHSQGMNLWLMTSPEYHMKRLL----VAGCGPVFQLCRSFRNEE--MGRYHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCPAAESLSYQQAF--LRYLEIDPLSADKTQLREVAAKLDLSNVAD--TEEDRDTLLQLLFTFGVEPNIGKEKPTFVYHFPASQASLAQISTEDVAERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAA-QNLIEALKVGMPDCSGVALGVDRLVMLALGAETLAEVI--AFS........... 335
20 -43.9004ah6_A mol:protein length:617 ASPARTATE--TRNA LIGASE, MITOCHONDRIAL  ali model follow..  15  144MQYNLRLRSQMVMKMREY----LCNLHGFVDIETPTLFKRTPGGAKEF--------LVPSREPGKFYSLPQSPQQFKQLLM----VGGLDRYFQVARCYR-DEGSRPDRQ--EFTQIDIEMSFVDQTGIQSLIEGLLQYSWPNDKDPVVVPFPTMTFAEVLPDTRFGMKIIDISDVFRNTEIGFLQDALSTLFSFLWVVDFPLFLPKEENPRELESAHHPFTAPHPSDIHLLYTERSQHYDLVLNGNEIGGGSIRIHNAELQRYILATLKEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIA--FPKSFRG...... 571
21 -43.5004o2d_A mol:protein length:620 Aspartate--tRNA ligase  ali model follow..  14  149PGNALRLRSKVNAAARSVLAEH-----DFVEIETPTLTRSTPEGARDFL-------VPARLQPGSFYALPQSPQLFKQLLM----VAGMERYYQIARCYR-DEDFRADRQ--EFTQLDMEMSFVEADDVIAISEQVLKAVWATIGYD-------------LPLPLPRISYEEAMRRFGSDKPDLRFGIELVECTEYFKDTTFRVFQAPVGSGAWTAMHHAFTAPKPDSVDTFDSDLSDAYDIVCNGNEIGGGSIRIHRRDIQERVFAMHDEAQEKFGFLLDAFSYGAPPHGGIAFGWDRITALLAGVDSIREVIA--FPKSGGG...... 576
22 -42.6004wj3_M mol:protein length:599 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  14  139MAAKLKLRARITSSIRRYL-----DDNGFLDVETPILGRPTPEGARDYL-------VPSRTYPGHFFALPQSPQLFKQLLM----VAGFDRYYQIAKCFR-DEDLRADRQ--EFTQIDIETSFLDESDIIGITEKMVRQLFKEVLDV-------------EFDEFPHMPFEEAMRRYGSDKPDLRHDLKLLTREWAPMWVVDFPMFEENDDGSLSALHHPFTSPKCTPAELEANPLSRAYDMVLNGTELGGGSIRIHDKSMQQAVFRVEAEQEEKFGFLLDALKYGAPPHGGLAFGLDRLVMLMTGASSIREVIA--FPKTQSA...... 563
23 -41.8001eqr_A mol:protein length:590 ASPARTYL-TRNA SYNTHETASE  ali model follow..  14  134MAQRLKTRAKITSLVRRFMDDH-----GFLDIETPMLTKATPEGARDYL-------VPSRVHKGKFYALPQSPQLFKQLLM----MSGFDRYYQIVKCFR-DEDLRADRQ--EFTQIDVETSFMTAPQVREVMEALVRHLWLEVKGV-------------DLGDFPVMTFAEAERRYGSDKPDGKDLGLTDESKWAPLWVIDFPMFEDDGEGGLTAMHHPFTSPKDMTAAELKAAVANAYDMVINGYEVGGGSVRIHNGDMQQTVFGIEEEQREKFGFLLDALKYGTPPHAGLAFGLDRLTMLLTGTDNIRDVIA--FPKTTAAACL... 563
24 -35.6004up7_A mol:protein length:777 LYSINE--TRNA LIGASE  ali model follow..  11  162LDLIVNPESVKNFVLRTKVVKAVRKYLGFLEVETPILNTIPGGATARPFITHHNQ-------LDIQMYMRIAPELYLKELV----VGGINRVYEIGRLFR--NEGIDQTHNPEFTTCEFYMAYADYNDIMKMTEELLGNMVKDITGG-STKLEIKDRLMDINNEEDIKMLEKFFKEFNSAECSKVIEKHCTELNPEALTFLKKQAIRFNAICAEPQTQPQLMSPLAKYHR-SEPELTERFELFILKREIANAYTELNNPIVQRSNFEQQAKDKAADEVFLDAIEHAFPPTGGWGLGIDRLAMLLADVDNIKEVIL--FPTMRPE...... 564
25 -35.5003bju_A mol:protein length:521 Lysyl-tRNA synthetase  ali model follow..  11  164LDLILNDFVRQKFIIRSKIITYIRSFLGFLEIETPMMNIIPG-------GAVAKPFITYHNELDMNLYMRIAPELYHKMLV----VGGIDRVYEIGRQFR--NEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHP-AYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDRLLDKLVGEEVTCINPTFICDHPQIMSPLAKWHRSKLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAA-ENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVL--LFP........... 503
26 -35.0005hgq_A mol:protein length:524 Lysine--tRNA ligase  ali model follow..  11  166LDLIMNPDVKNRFVTRSRMISFLRRYLGFLEVETPMMNLIAG-------GATAKPFITHHNDLDMDLYLRVAPELYLKMLV----VGGIDRVYEIGRVFR--NEGIDQTHNPEFTSCEFYMAYADYEDLMKITEDMLARMVYYMHGTYKIQYH--VYEVDFTPPFRKVNIYDGLQEKLGIQFPPADTLDTDEANKFFDKRLLDKLIGEEPTFISPTFLTGHPQIMSPLAKWHRSILTERFELFVVTKEIVNAYTELNDPLTQRLRFDEQAKQKQA-ENYCTALEYGLPPTAGWGMGIDRLAMILTDSNNIKEVL--FFP........... 506
27 -34.6001e1o_A mol:protein length:504 LYSYL-TRNA SYNTHETASE, HEAT INDUCIBLE  ali model follow..  12  171LDLIANDKSRQTFVVRSKILAAIRQFMGFMEVETPMMQVIPG-------GASARPFITHHNALDLDMYLRIAPELYLKRLV----VGGFERVFEINRNFR--NEGISVRHNPEFTMMELYMAYADYHDLIELTESLFRTLAQEVLGTTKVTYG--EHVFDFGKPFEKLTMREAIKKYRPETDMADLDNFDAAKALAESIGITTEIFDEEAHLIQPTFITEYPAEVSPLARRNDVNITDRFEFFIGGREIGNGFSELNDAEDQAERFQEQVNAKAA-EDYVTALEYGLPPTAGLGIGIDRMIMLFTNSHTIRDVI--LFP........... 498
28 -34.6005eln_A mol:protein length:535 Lysine--tRNA ligase  ali model follow..  12  174LDLMLNEESRKVFKLRSRAIKYIRNYFGFLEVETPMLNMIYG-------GAAARPFITYHNELETQLYMRIAPELYLKQLI----VGGLDKVYEIGKNFR--NEGIDLTHNPEFTAMEFYMAYADYYDLMDLTEELISGLVLEIHGSLKIPYHP-CIEIDFTTPWKRFSFVEEIESGLGEKLKRPLDSQENIDFMVLLDKLAGHFVE--TKCTNPSFIIDHPQTMSPLAKWHREKMTERFELFVLGKELCNAYTELNEPLQQRKFFEQQADAKAS-ETFCLALEHGLPPTGGWGLGIDRLIMFLADKNNIKEVI--LFP........... 511
29 -34.5006aqh_A mol:protein length:508 Lysine--tRNA ligase  ali model follow..  14  169VDLIVRDQARKVARQRIAVMRAIRSALGFLEVETPMLQTLAG-------GAAARPFVTHSNALDTELYLRIAPELFLKRCL----VGGFERVFELNRVFR--NEGADSTHSPEFVMLETYQAYGTYDDSAVVTRELIQEVADEAIGT-RQVPLPDGTVYDLDGEWESIQMYPSLSEITPDTPAETLWAIADRLGL-LVEELWEHTVG--AKLWAPTFVKDFPVETTPLTRSHRSIVTEKWDLYVRRIELATGYSELTDPIIQRERFEAQARAAAA-EDFLAALEYGMPPSTGTGMGIDRLMMTLTG-LSIRETV--LFP........... 497
30 -34.3001bbu_A mol:protein length:504 PROTEIN (LYSYL-TRNA SYNTHETASE)  ali model follow..  12  171LDLISNDESRNTFKVRSQILSGIRQFMGFMEVETPMMQVIPG-------GAAARPFITHHNALDLDMYLRIAPELYLKRLV----VGGFERVFEINRNFR--NEGISVRHNPEFTMMELYMAYADYKDLIELTESLFRTLAQDILGKTEVTYG--DVTLDFGKPFEKLTMREAIKKYRPETDMADLDNFDSAKAIAESIGIHTEIFEEEAHLIQPTFITEYPAEVSPLARRNDVNITDRFEFFIGGREIGNGFSELNDAEDQAQRFLDQVAAKDA-EDYVTALEHGLPPTAGLGIGIDRMVMLFTNSHTIRDVI--LFP........... 498
31 -34.2003a74_A mol:protein length:493 Lysyl-tRNA synthetase  ali model follow..  14  162LDLIMNPESKKTFITRSLIIQSMRRYLGYLEVETPMMHAVAG-------GAAARPFITHHNALDMTLYMRIAIELHLKRLI----VGGLEKVYEIGRVFR--NEGISTRHNPEFTMLELYEAYADFRDIMKLTENLIAHIATEVLGTTKIQYG--EHLVDLTPEWRRLHMVDAIKEFWRQMSDEEARELAKEHGV-IVNEFFEQKVE--DKLIQPTFIYGHPVEISPLAKKNPDDFTDRFELFIVGREHANAFTELNDPIDQRQRFEEQLKEREQ-EDFLEALEYGMPPTGGLGIGVDRLVMLLTNSPSIRDVL--LFP........... 488
32 -34.2004ycv_A mol:protein length:516 Lysine--tRNA ligase  ali model follow..  11  164LDLLINESSRHTFVTRTKIINFLRNFLGFFEVETPMMNLIAG-------GANARPFITHHNDLDLDLYLRIATELPLKMLI----VGGIDKVYEIGKVFR--NEGIDNTHNPEFTSCEFYWAYADYNDLIKWSEDFFSQLVYHLFGTYKDGPENQPIEIDFTPPYPKVSIVEEIEKVTNTIIKEHKIELPNPPTAAKLLDQLASHFIENKYNDKPFFIVEHPQIMSPLAKYHRTKLTERLEMFICGKEVLNAYTELNDPFKQKECFKLQQKDREK-SAFCTSLEYGLPPTGGLGLGIDRITMFLTNKNSIKDVI--LFP........... 502
33 -34.1004ex5_A mol:protein length:529 Lysine--tRNA ligase  ali model follow..  13  186VDLIVTPETRTTFRARTKAIASIRKFMDFMEVETPMLHPIPG-------GAAAKPFVTHHNALDMEMFLRIAPELYLKRLI----VGGFERVFEINRNFR--NEGVSPRHNPEFTMMEFYAAYTDYRWLMDFTERLIRQAAVDALGTATIQYQ--GRELDLAQPFHRLTITQAIQKYAPSYTDGQLSDDAFLRSELKRLGVDVTQPAFEAQLWEPTFIIDYPIEVSPLARESDTVITERFELFITGREIANGFSELNDPEDQAARFKKQVEQKDA-ADYIRALEYGMPPTGGCGIGIDRLVMLLTDSPTIRDVL--LFP........... 517
34 -34.0005vl1_A mol:protein length:506 Lysine--tRNA ligase  ali model follow..  12  166VDLIVRPQAREVARQRIAVIRAVRNALGFLEVETPMLQTLAG-------GAAARPFVTHSNALDIDLYLRIAPELFLKRCI----VGGFDRVFELNRVFR--NEGSDSTHSPEFSMLETYQTYGTYDDSALITRELIQEVADEAIGTRQLSMPD-GSVYDIDGEWATMEMYSSLSEITPETTVARLRDIASGLDV-LVEELWEHAVG--NKLTAPTFVKDFPVETTPLTRQHRSIVTEKWDLYVRGVELATGYSELNDPVVQRDRFADQARAAAA-EDFLTALEYGMPPCTGTGMGIDRLLMCLTG-LSIRETV--LFP........... 493
35 -33.1006chd_A mol:protein length:597 Lysine--tRNA ligase  ali model follow..  11  232LDLILNDFVRQKFIIRSKIITYIRSFLGFLEIETPMMNIIPG-------GAVAKPFITYHNELDMNLYMRIAPELYHKMLV----VGGIDRVYEIGRQFR--NEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHP-AYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDRLLDKLVGEEVTCINPTFICDHPQIMSPLAKWHRSKLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAA-ENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVL--LFP........... 571
36 -20.0002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  82......KHRPALLELEEKLAKALHQQ-GFVQVVTPTIITKSALAKMTIGEDHPLFSQVFWLDGKKCLRPMLAPNLYTLWRELERLWDKPIRIFEIGTCYRKESQ--GAQHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAA-------------------------------------------------------------------------IREFELVTES------------SVVYGDTVDVMKGDLELASGAMGPHFLDEKWEIFD--------------PWVGLGFGLERLLMIREGTQHVQSMARSLSYLDGVRL..... 299
37 -18.7004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  12  69......ERENYLGKLEREITRFFVDR-GFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKES--DGKEHLEEFTMLSFIQM--GSGCTRENLESIITDFLNHLGIDFKIVGDSC--------------------------------------------------------------------------------YGDTLDVMHGDLELSSAV--VGPIPLDREWGID-------------------KPWIGAGFGLERLLKVKHDFKNIKRAARS.............. 274
38 -18.7005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  12  52......ERENYLGKLEREITRFFVD-RGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESD--GKEHLEEFTMLAFAQM--GSGCTRENLESIITDFLNHLGIDFKIVGDSC------------------------------------------------------------------------------MVYGDTLDVMHGDLELSSAV--VGPIPLDREWGID-------------------KPWIGAGFGLERLLKVKHDFKNIKRAARS.............. 257
39 -17.9004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  14  50.....EERENYLGKLEREITRFFVD-RGFLEIKSPILIPLEY---ERMGIDNDTELSKQIFRVDKNFCLMVAPNIFNYARKLDRALPDPIKIFEIGPCYRKESD--GKEHLEEFTMLNFFQM--GSGCTRENLESIITDFLNHLGIDFKIVGDSCSV------------------------------------------------------------------------------YGDTLDVMHGDLELSSAV--VGPIPLDREWGID-------------------KPWIGAGFGLERLLKVKHDFKNIKRAARS.............. 256
40 -17.2002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  14  69......ERENYLGKLEREITRFFVDR-GFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKE--SDGKEHLEEFTMLNFCQMGSGCENLESIITDFLNHL------------------------IDFKIVGDSCMVYGDT-----------------------------------------------------------LDVMHGDLELSSAV--VGPIPLDREWGID-------------------KPWIGAGFGLERLLKVKHDFKNIKRAARS.............. 274
41 -14.7004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  69......ERENYLGKLEREITRFFVD-RGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLGNYLRKLDRALPDPIKIFEIGPCYRKESD--GKEHLEEFTMLNFCQM--GSGCTRENLESIITDFLNHL.......................................................................................................................................................................................... 201
42 -14.0003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  66......ERENYLGKLEREITRFFVD-RGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLTPNLYNYLRKLDRALPDPIKIFEIGPCYRKESD--GKEHLEEFTMLVFWQM--GSGCTRENLESIITDFLNHL.......................................................................................................................................................................................... 198
43 -13.2004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  52......ERENYLGKLEREITRFFVD-RGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLANYLRKLDRALPDPIKIFEIGPCYRKESD--GKEHLEEFTMLNFCQM--GSGCTRENLESIITDFLNHL.......................................................................................................................................................................................... 184
44 -12.4002cim_A mol:protein length:522 SERYL-TRNA SYNTHETASE  ali model follow..  10  225........ARIFRTFEKIVLEELLEPLGYREMIFPKLVTWEPPQTRDPDYWEEPTKLIKEKIAEPIGGMCYAQMYVAGETLPNEEIP---KVFDRSGTSHRYESGGIHERVDEFHRIEI-VWIGTKEEVLKCAEELHDRYMHIFNDILDIEWRKARVTPW------FMAQEGLLGLAEENTVGTTDYEACLPYRG------------------------------------------------PDGEWLEFQNVSINGDKYPKG-------------FNVKLQSGDELWSGCSGVGLERWAAVFLAQKGLDP---ANWPEEFRNRVGEM. 509
45 -11.8002rhq_A mol:protein length:294 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  13  45.......SKHPLTRTVEEIEDLFLG-LGYEIVDGYEVEQDYYNFEALNLPKSHPADMQDSFYITDEILMRTHTSPVQARTMEKRNGQGPVKIICPGKVYRRDS--DDATHSHQFTQI--EGLVVDKNIKMSDLKGTLELVAKKLFGADREIRLRPSYFPFTEPSVEVDVSCFKCKGKGCNVCKHTG------------------------------------------------------------IEILGAGM------VHPNVLEMAGFDSNEYSGF------------AFGMGPDRIAMLKYGIEDIRYFYTN.............. 272
46 -10.5003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  11  29MQDGYPDFAKRRRAVETRLLSFV-EDAGYEPVTSGLF-EYVDTLLRARSPESSRDWIRLFDGGGDAVALRPTPSIARMAAPRVAAGRTPIRWCYCERVYRRTDDPASLSKAAESTQVGIERIGEEASDVLRLLHEASAALVPRLLDALGISASLSRAFLACLTSGNYVQFRELWQLHAAKDVDLLANLLTREASDRELEALLRDAVDPRAAADVRDAWRYLCRLAE-HDSGLASDVVTFDLALHRELDYYTGLVEMFAPGVGAPIAQGGRYDELLAQF------GAGAPAVGFAFEVERVMAVLEAQEEGEG.................. 371
47 -10.3001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  14...DFYPEDMDVEKFIFKTAEEAAEAFGFRRIDFPSLEYL------DLYRIKSGEELLQQTYSGREVTLPEATPSTVRMVTSRKDLQRPLRWYSFPKVWRYEEPQAGRYR--EHYQFNADIFGSDS-EVIALASSILDRL--GLQDIYEIRINSRKIMEEIIGGMTSSDPFSVFSIIDRYHKISREEFVDQLRSAGIGEDGVSMIADLCSGTRGIDEMARITGKSSEEIARMAAKNVRYDFSIVRGLSYYTGIV----EAYDRSGQFRAILGGGRYDNLASLMSGESVPAVGFGMGDAVISLLLKREREKKSVYICRVGKINSSIMNEYS 352
48 -10.3003pco_A mol:protein length:327 Phenylalanyl-tRNA synthetase, alpha subunit  ali model follow..  11  105.......GLHPVTRTIDRIESFFGE-LGFTVATGPEIEDDYHNFDALNIPGHHPARADHDTFWFDTTRLLRTQT--SGVQIRTMKAQQPPIRIIAPGRVYRND--YDQTHTPMFHQM--EGLIVDTNISFTNLKGTLHDFLRNFFEEDLQIRFR--------------------------------------------------------------SYFPFTEPSAEVDVMGKN---------GKWLEVLGCGM------VHPNVLRNVGIDPEVYSGF------------AFGMGMERLTMLRYGVTDLRSFFEN.............. 318
49 -10.0004h2w_A mol:protein length:346 Amino acid--[acyl-carrier-protein] ligase 1  ali model follow..  10  56..........LYESIVERLAALITSEAGTEALRFPPVMSRAEREINAAVSRFDAGGDWTTSLSPADLVLSPAACYPVYPIAASRGPLPKGGLFDVAADCFRREPSKHLDRLQSFRMREY-VCIGTPDDVSDFRERWMVRAQAIARD--------LTFRVDYASDPFFGRAGKMLANNQRDQQLKFELLI---------------------------------------------------PLRSEEQPTACMSFNYHREHFGTT-------------WGIQDANGEPAHTGCVAFGMDRLAVAMFHTHGTDLSA---WPAKVRDIL.... 324
50 -10.0001b70_A mol:protein length:350 PHENYLALANYL-TRNA SYNTHETASE  ali model follow..  15  99.......GLHPITLMERELVEIFRA-LGYQAVEGPEVESEFFNFDALNIPEHHPADTFWLTGEGFRLEGPLGEEVEGRLLLRTHTSPM--RIVVPGRVFRFEQ--TDATHEAVFHQL--EGLVVGEGIAMAHLKGAIYELAQALFGPDSKVRFQ--------------------------------------------------------------VYFPFVEP--------GAQFAVWWPEGGKWLELGGAGM------VHPKVFQAVDAYRERLGLPPAYRGV---TGFAFGLGVERLAMLRYGIPDIRYFFGG.............. 338
51 -9.8903w3s_A mol:protein length:527 Type-2 serine--tRNA ligase  ali model follow..  222........AALFEVLRDFLLERVTRKLGFEPALFPKLIPLECPPKRDPELFDDTLGSLKEKLRDPGYVLAPAQCEPFYELLRDEVVDPERKLYDCSGWTYRWEGGAAKERVNEFQRIEH-VWIAEPEEAYRIRRELLEATKRVAEE---------------------LELEWKVVVSDDPFYLEGRLLEDRDIELPDVPSYEFEVY----------------LPFKGERSSEEA-------------WISVGSFNVHGEHFVDGFNVKEKSGRTLF-------------TGCAGLGVTRWVVGLLAQHGFYP---YEWPEPILERIDEKF 513
52 -9.7703hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  31...DFPPEAMRCRRHLFDVFHATAKTFGFEEYDAPVLESEELYIRKAGEEITEQM-FNFITKGGHRVALRPTPSLARLLLGKGRSLLLPAKWYSIPQCWRYEAITRGRRR--EHYQWNMDIVGVKS-ELVCAACWAMRSLLQTVVEQAGVTSDKFAPVCVIVDKMEKIPREEVEAQLAVLGLEPTV---VDAITTTLSLKSIDEIAQRVGEEHEA--VKELRQFFEQVEAYGYGDWVLFDASVVRGLAYYTGIV----EGFDREGKFRALCGGGRYDNLLTTYGSPTPPCAGFGFGDCVIVELLQEKRLLPDIPHVV............. 356
53 -9.6303l4g_A mol:protein length:508 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  11  223.......HLHPLLKVRSQFRQIFLE-MGFTEMPTDNFIESSFWNFDALFQPQQARDQHDTFFLRDPAEALQLPMDYVQRVKRTHSQGGY-KYFSIDRVFRNE--TLDATHLAEFHQI--EGVVADHGLTLGHLMGVLREFFTKLGITQLRFK----------------------------------------------------------------AYNPYTEP--------SMEVFSYHQGLKKWVEVGNSGV------FRPEMLLPMGLPENVSVI-------------AWGLSLERPTMIKYGINNIRELVGPRPPPTQE....... 506
54 -9.5601z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  22SAEMTLNQVKSLRQIEGRLRKLF-SLKNYQEVMPPSFTQLYTALESNGKTFNQEKMFQFIKHEGQSITLRYDFTLPLVRLYSQIKDSTSARYSYFGKIFRKEKRHKGRST--ENYQIGIELFGESA-EILSLALQVIEQLLCQLADGSTELLTELLLKKDLSGLNAFIEKNNFSKELRGLLKEIFITNELSRLENLVTNTKDDVLISSFDQLKEFSEKLSMIKPIIIDLGMVPKDLMFKAYSSAANQPILSGG---RYDQLLSNF-------------------QEEAFAIGFCCHMDTILKAL.......................... 328
55 -9.5203mey_A mol:protein length:346 Bll0957 protein  ali model follow..  57...........YESIVERLAALITSEAGTEALRFPPVMSRAEREINAAVSRFDAGGDWTTSLSPADLVLSPAACYPVYPIAASRGPLPKGGLFDVAADCFRREPSKHLDRLQSFRMREY-VCIGTPDDVSDFRERWMVRAQAIARD--------LTFRVDYASDPFFGRVGQMKAVSQKQQQLKFELLI---------------------------------------------------PLRSEEQPTACMSFNYHREHFGTTWGIQDANGEPAH-------------TGCVAFGMDRLAVAMFHTHGTDLSA---WPAKVRDIL.... 324
56 -9.5104g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  12  75...DYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGK--YGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLTNI-KRYHIAKVYRRDNPAMTRGRYREFYQCDFDIAMIPDAECLKIMCEILSSLLDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDDKISFDLSLARGLDYYTGVIEAVLLQTPAQAGEEPLGVGSRYDGLVGMFDPKGRPCVGLSIGVERIFSIVEQRLEA-QVLVASAQKKLLEERLKLV 439
57 -9.4506FTT Entity 1(prereleased)  ali follow..  10  7VADVLFEDAHKQEVLRHQLTQQL-ITHGYQLVSPPMIEFTESLLSGASEDLKRQTFKIIDQLTGRLMGIRADITPQILRIDAHHGGDGIARYCYAGDVIHTLPSGLFGSR--TPLQLGAEISIAADIELIDVLFSMINSLVTIFKRLAELAALSASDTEQLMQLYANKNLPELKQVCQVLPMGSDFYTLARFGHD--IANLLGRLSENAQQDTKIVTAIDELQRLKAHLQVQWQCAVSIDVTELSGYHLVRGG---RFDGMKSNQLATNQPR----------------QATGFSMDVSRLLAHTQLDAPFIVLIDYDA............ 333
58 -9.4505m8h_A mol:protein length:388 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  10  7VADVLFEDAHKQEVLRHQLTQQL-ITHGYQLVSPPMIEFTESLLSGASEDLKRQTFKIIDQLTGRLMGIRADITPQILRIDAHHGGDGIARYCYAGDVIHTLPSGLFGSR--TPLQLGAEISIAADIELIDVLFSMINSLVTIFKRLAELAALSASDTEQLMQLYANKNLPELKQVCQVLPMGSDFYTLARFGHD--IANLLGRLSENAQQDTKIVTAIDELQRLKAHLQVQWQCAVSIDVTELSGYHLVRGG---RFDGMKSNQLATNQPR----------------QATGFSMDVSRLLAHTQLDAPFIVLIDYDA............ 333
59 -9.4104g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  12  22...DYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGK--YGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLTNI-KRYHIAKVYRRDNPAMTRGRYREFYQCDFDIAMIPDAECLKIMCEILSSLLDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDDKISFDLSLARGLDYYTGVIEAVLLQTPAQAGEEPLGVGSRYDGLVGMFDPKGRPCVGLSIGVERIFSIVEQRLEA-QVLVASAQKKLLEERLKLV 386
60 -9.3403net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  11  20...EFLPSEKRLELYLLDTIRRVYESYGFTPIETPVLQAKGNQGDNIIYGLEPILPDKSGDTGSEARALKFTVPLAAYIARHLNDLTFPFARYQMDVVFRGERAKDGRFR--QFRQCDIDVVGREK-QMPAIITEIFRKVLTGFFQSLNISETQIKSCISIIDNLEKIGEAKVKLELEKEGINPEQDFVKIDGSVDDVLDKLKHLSQTLPESEQFNLGVSELETVITGVRNLGDKRFCIDLAIARGLNYYTG---VYETTLIGHEALGSICSGGRYEELVGTFIGEKMPGVGISIGLTRLISRLLKAGILNTLPPT.............. 370
61 -9.0504p71_C mol:protein length:338 Phenylalanine--tRNA ligase alpha subunit  ali model follow..  12  105.......GLHPVTRTLERIEQCFSR-IGYEVAEGPEVEDDYHNFEALNIPGHHPARAMHDTFYFNANMLLRTHTSPVQVRTMESQQPPI-RIVCPGRVYRCDSDL---THSPMFHQV--EGLLVDEGVSFADLKGTIEEFLRAFFEKQLEVRFRPSFFPFTEPSA-------------------------------------------------EVDIQCVICSGNGCRVCKQTGWL----------EVMGCGM------VHPNVLRMSNIDPEKFQGF------------AFGMGAERLAMLRYGVNDLRLFFDN.............. 329
62 -9.0405e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  14...DVLPTQTAAWRRLEQHLASLMDAYGYQQIRLPIVEQTGKRAIGDATDIVEKEMYTFFDKGNPPESLTLRPECVRALVEHNLLRGATPRVWYMGPMFRYEKPQKGRYR--QFHQFGVETFGVAT-ELIMLTARLWKRMKDALDEDSQRRLTTNPLRILDSKIESTQKILENAPKLHDFLKEDSLSHFQQLQDYLTAAGIKFVINQKLVRGLDYYNKTVFEWTTTA---------------LGSQGTVCAGG---RYDGLVGQLKGKADQS----------------PAVGFAMGMERLLLLLEQVEQAEIVRDCEA............ 336
63 -9.0203hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  31...DFPPETMRLRKYLFDVFHSTARKFGFEEYDSPVLESEELYIRKAGEEITEQM-FNFITKGGHRVALRPTPSLARQLLAKGRSLLLPAKWYSIPQCWRYEAITRGRRR--EHYQWNMDIIGVKS-ELVCAACTAMRKILQTVVEQAGVSADKFAPVCVIVDKMEKLPREEVVAQLAAIGESNVVDAITSTLSLKTIDEIAQRIGEEHEAVRELRDFITFDASVVRGLAYYTGIVFEGFDRDGNFRALCGGG---RYDNLLTTYGSPTAV-----------------PCVGFGFGDCVIVELLNEKKLLPELHHVV............. 356

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 6 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Awobuluyi M, Yang J, Ye Y, Chatterton JE, Godzik A, Lipton SA, Zhang D. Subunit-specific roles of glycine-binding domains in activation of NR1/NR3N-methyl-D-aspartate receptors. Mol Pharmacol. 2007 Jan;71(1):112-22. Epub 2006 Oct 17.