current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 1asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490
# Score Template Links and tools%idFirst EDTAKDNYGKLPLIQSRDSDRTGQKRVKFVDLDEAKDSDKEVLFRARVHNTRQQGATLAFLTLRQQASLIQGLVKANKEGTISKNMVKWAGSLNLESIVLVRGIVKKVDEPIKSATVQNLEIHITKIYTISETPEALPILLEDASRSEAEAEAAGLPVVNLDTRLDYRVIDLRTVTNQAIFRIQAGVCELFREYLATKKFTEVHTPKLLGAPSEGGSSVFEVTYFKGKAYLAQSPQFNKQQLIVADFERVYEIGPVFRAENSNTHRHMTEFTGLDMEMAFEEHYHEVLDTLSELFVFIFSELPKRFAHEIELVRKQYPVEEFKLPKDGKMVRLTYKEGIEMLRAAGKEIGDFEDLSTENEKFLGKLVRDKYDTDFYILDKFPLEIRPFYTMPDPANPKYSNSYDFFMRGEEILSGAQRIHDHALLQERMKAHGLSPEDPGLKDYCDGFSYGCPPHAGGGIGLERVVMFYLDLKNIRRASLFPRDPKRLRPLast
1 -158.0001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model  100  1EDTAKDNYGKLPLIQSRDSDRTGQKRVKFVDLDEAKDSDKEVLFRARVHNTRQQGATLAFLTLRQQASLIQGLVKANKEGTISKNMVKWAGSLNLESIVLVRGIVKKVDEPIKSATVQNLEIHITKIYTISETPEALPILLEDASRSEAEAEAAGLPVVNLDTRLDYRVIDLRTVTNQAIFRIQAGVCELFREYLATKKFTEVHTPKLLGAPSEGGSSVFEVTYFKGKAYLAQSPQFNKQQLIVADFERVYEIGPVFRAENSNTHRHMTEFTGLDMEMAFEEHYHEVLDTLSELFVFIFSELPKRFAHEIELVRKQYPVEEFKLPKDGKMVRLTYKEGIEMLRAAGKEIGDFEDLSTENEKFLGKLVRDKYDTDFYILDKFPLEIRPFYTMPDPANPKYSNSYDFFMRGEEILSGAQRIHDHALLQERMKAHGLSPEDPGLKDYCDGFSYGCPPHAGGGIGLERVVMFYLDLKNIRRASLFPRDPKRLRP 490
2 -138.0004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  58  36EDYAKERYGISSMIQ--SQEKPDRVLVRVRDL-TIQKADEVVWVRARVHTSRAKGK-QCFLVLRQQQFNVQALVAVGDHA--SKQMVKFAANINKESIVDVEGVVRKVNQKIGSCTQQDVELHVQKIYVISLAEPRLPLQLDDAVRPEAEGEEEGRATVNQDTRLDNRVIDLRTSTSQAVFRLQSGICHLFRETLINKGFVEIQTPKIISAASEGGANVFTVSYFKNNAYLAQSPQLYKQMCICADFEKVFSIGPVFRAEDSNTHRHLTEFVGLDIEMAFNYHYHEVMEEIADTMVQIFKGLQERFQTEIQTVNKQFPCEPFKF--LEPTLRLEYCEALAMLREAGVEMGDEDDLSTPNEKLLGHLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNSYDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEK--IKAYIDSFRFGAPPHAGGGIGLERVTMLFLGLHNVRQTSMFPRDPKRLTP 515
3 -130.0001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  34  2........................YRTHYSSEITEELNGQKVKVAGWVWEVKDLGG-IKFLWIRDRDGIVQITAPKK---KVDPELFKLIPKLRSEDVVAVEGVVNFTPKAKLG-----FEILPEKIVVLNRAETPLPLDPTGKVK------------AELDTRLNNRFMDLRRPEVMAIFKIRSSVFKAVRDFFHENGFIEIHTPKIIATATEGGTELFPMKYFEEDAFLAESPQLYKEIMMASGLDRVYEIAPIFRAEEHNTTRHLNEAWSIDSEMAFIEDEEEVMSFLERLVAHAINYVREHNAKELDILNFELE------EPKLPFPRVSYDKALEILGDLGKEIPWGEDIDTEGERLLGKYMMENENAPLYFLYQYPSEAKPFYIMKYDNKPEICRAFDLEYRGVEISSGGQREHRHDILVEQIKEKGLNPES--FEFYLKAFRYGMPPHGGFGLGAERLIKQMLDLPNIREVILFPRDRRRLTP 438
4 -125.0003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  51  25ELVSGENFKVMPMHQSQPCYKTGLKYTEIEELVP-AMAEKTVTIRARVQAVRGKGN-MVFLFLRKGIYTCQALVMKSET--ISKEFVQFCQKISAESICDITGIVKAVEKPIEKATQQDVEIHVTSIAVVSLAEYPLPMQIEDLTFPSSVFKAQKYVKVSQDTRLDNRMLDLRTVTNIAIFRIQSACCGLFREFLTSQKFVEIHTPKLIGCSSEGGSNIFEVKYFDRKAYLAQSPQLYKQMAIMGDFRKVFEVGPVFRAENSNTRRHLTEFEGLDIEMEIVENYHECIDVMEKLFTFIFDEIPKRFPDELKVIRKQYP---FEDLIYRPFLRLTYKEAIEMLRASGETIGDYDDFTTPQEVKLGELIKAKYNTDFYILDKFPAAIRPFYTMPDIDDPNYSNSYDVFVRGQEITSGAQRIHDPEFLMKRCIEKGVDPAT--LKDYIESFRFGSWPHAGCGIGLERITMLYLGIPNIRKVTLFPRDPIRLNP 548
5 -121.0003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  24  1........GPGSMMTEATTTVETPIVCNIRDAA--GLEGKLVTFKGWAYHIRKARKTLIFVELRDGSGYCQCVIFGKELCE-----PEKVKLLTRECSLEITGRLNAYAGKNHPADILNLEMQVTEWKVIGESPIDLE--------------NIINKDSSIPQKMQNRHIVIRSEHTQQVLQLRSEIQWYFRKYYHDNHFTEIQPPTIVKTQCEGGSTLFKLQYFNEPAYLTQSSQLYLE-SVIASLGKSFCMLSSYRAEQSRTVRHLAEYLHLEAELPFIS-FEDLLNHLEDLVCTVIDNVMAVHGDKIRKMNPHLK------LPTRPFKRMTYADAIKYCNDHGILNKDKPFEYGEDISEKPERQMTDEIGCPIFMIHFPSKMKAFYMSKVPGHPDLTESVDLLMPGGEIVGGSMRIWNYDELMGAYKANGLNPDP--YYWYTQQRKYGSCPHGGYGLGVERLVMWLLGEDHIRKVCLYPRYLERCEP 456
6 -118.0001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  35  1..........................MRVLVRDLKAHVGQEVELLGFLHWRRDLGR-IQFLLLRDRSGVVQVVTGGL-------------KLPLPESALRVRGLVVENAK-----APGGLEVQAKEVEVLSPALEPTPVEIPKE-----------EWRANPDTLLEYRYVTLRGEKARAPLKVQAALVRGFRRYLDRQDFTEIFTPKVVRAGAEGGSGLFGVDYFEKRAYLAQSPQLYKQ-IMVGVFERVYEVAPVWRMEEHHTSRHLNEYLSLDVEMGFIADEEDLMRLEEALLAEMLEEALNTAGDEIRLLGATWP------SFPQDIPRLTHAEAKRILKEELGY-PVGQDLSEEAERLLGEYAKERWGSDWLFVTRYPRSVRPFYTY--PEEDGTTRSFDLLFRGLEITSGGQRIHRYEELLESLKAKGMDPEA--FHGYLEVFKYGMPPHGGFAIGAERLTQKLLGLPNVRYARAFPRDRHRLTP 422
7 -117.0001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  30  3........................EKVYCQEVKP-ELDGKKVRLAGWVYTNMRVGK-KIFLWIRDSTGIVQAVVAKN---VVGEETFEKAKKLGRESSVIVEGIVKADER-----APGGAEVHVEKLEVIQAVSEFPI--------------PENPEQASPELLLDYRHLHIRTPKASAIMKVKETLIMAAREWLLKDGWHEVFPPILVTGAVEGGATLFKLKYFDKYAYLSQSAQLYLEAAI-FGLEKVWSLTPSFRAEKSRTRRHLTEFWHLELEAAWMD-LWDIMKVEEELVSYMVQRTLELRKKEIEMFRDDLTT---LKNTEPPFPRISYDEAIDILQSKGVNVEWGDDLGADEERVLTEEF-----DRPFFVYGYPKHIKAFYMKEDPNDPRKVLASDMLAGYGEIIGGSQREDDYDKLLNRILEEGMDPKD--YEWYLDLRRYGSVPHSGFGLGVERLVAWVLKLDHIRWAALFPRTPARLYP 434
8 -117.0001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  35  2.......................YRSHFIADVTP-EYDGKEVIWAGWVHLLRDLGG-KKFIILRDKTGLGQVVVDKN------SSAFGISQELTQESVIQVRGIVKADKRAP-----RGIELHAEEITLLSKAKAPLPLDVSGKVK------------ADIDTRLRERVLDLRRQEMQAVIKIQSLALKAFRETLYKEGFIEIFTPKIIASATEGGAQLFPVIYFGKEAFLAQSPQLYKE-LMAGVVERVFEVAPAWRAEESDTPFHLAEFISMDVEMAFAD-YNDVMQLLEKILHNIVKTIKEEGKEELKILNYEPP------EVKIPIKRLKYTEAIEILRSKGYNIKFGDDIGTPEL----RILNEELKEDLYFIVDWPSDARPFYTKSKSENPELSESFDLIYKFLEIVSGSTRNHKREVLEEALKKKGLKPES--FEFFLKWFDYGMPPHAGFGMGLARLMVMLTGIQSVKEIVPFPRDKKRLTP 429
9 -117.0005xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  25  22...............KNDPSLPEPKCVKIGALE--GYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLADELCQC------YNGVLLSTESSVAVYGMLNLTPKGKQ--APGGHELSCDFWELIGLAPAGGADNLIN-------------EESDVDVQLNNRHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQSSQLYLETCL-PALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLT-FDDLLNRLEDLVCDVVDRILKSPAGSIVHEL-----NPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMNVGEIVGGSMRIFDSEEILAGYKREGIDPTP--YYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYPRFVQRCTP 466
10 -114.0002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  26  1........................TGVKIRDLV--KHRNERVCIKGWIHRMRRQGKSLMFFILRDGTGFLQVLLMDKLCQT------YDALTVNTECTVEIYGAIKEVPEGKE--APNGHELIADFWKIIGNAPPGGI-------------DNVLNEEASVDKMLDNRHLVIRGENAAALLRLRAAATRAMREHFYNAGYVEVAPPTLVQTQVEGGSTLFNLDYFGEQSFLTQSSQLYLETCIPT-LGDVFCIAQSYRAEKSRTRRHLAEYAHVEAECPFIT-LDDLMEKIEELVCDTVDRLLADEEAKKLLEH----INPKFQPPERPFLRMEYKDAIKWLQEHNVENEFGNTFTYGEDAEAAERFMTDTINKPILLNRFPSEIKAFYMQRDAKDNTLTESVDLLMPGGEIVGGSMRIWKFDELSKAFKNVEIDPKP--YYWYLDQRLYGTCPHGGYGLGLERFICWLTNTNHIRDVCLYPRFVGRCVP 437
11 -94.6003bju_A mol:protein length:521 Lysyl-tRNA synthetase  ali model follow..  19  20.....KVNGEDPYPHKFHVDISLTDFIQKYS-PGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKS-EEEFIHINNKLRRGDIIGVQGNPGKTKKG-------ELSIIPYEITLLSPCLHMLP--------------HLHFGLKDKETRYRQRYLDLLNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHLDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDL-THNPEFTTCEFYMAYAD-YHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGQAYDVDF--TPPFRRINMVEELEICVAKAVECPPPRTTARLLDKLVGEFLEVTC-INPTFICDHPQIMSP-LAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPE... 508
12 -93.7005eln_A mol:protein length:535 Lysine--tRNA ligase  ali model follow..  18  29.....KDAGRPFYPHKFKISMSLPAYALKYG-NGYIDKDTTLSLSGRVTSIRSSSSKLIFYDIFCEEQKVQIIANIMEHDISTGEFSVSHSEIRRGDVVGFTGFPGKSKRG-------ELSLFSKSVVLLSPCYHMLP--------------TAISGLKDQEVRYRQRYLDLLNEESRKVFKLRSRAIKYIRNYFDRLGFLEVETPMLNMIYGGAAARPFITYHLETQLYMRIAPELYLKQLIVGGLDKVYEIGKNFRNEGIDL-THNPEFTAMEFYMAYAD-YYDLMDLTEELISGLVLEIHGSLKIPYH--PDGPEGKCIEIDFTTPWKRFSFVEEIEMCEKHEIELPHPRTAAKLLDKLAGHFVETKC-TNPSFIIDHPQTMSP-LAKWHREKPEMTERFELFVLGKELCNAYTELNEPLQQRKFFEQQGDVEACPIDETFCLALEHGLPPTGGWGLGIDRLIMFLADKNNIKEVILFPAMRNV... 516
13 -93.3001efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model follow..  24  2........................RRTHYAGSLRETHVGEEVVLEGWVNRRRDLGG-LIFLDLRDREGLVQLVAHPASPAY------ATAERVRPEWVVRAKGLVRLRPEPNPRLATGRVEVELSALEVLAEAKTPPF-------PVDAGWRGEEEKEASEELRLKYRYLDLRRRRMQENLRLRHRVIKAIWDFLDREGFVQVETPFLTKSTPEGARDFLVPYRHGLFYALPQSPQLFKQMLMVAGLDRYFQIARCFRDEDLRADRQ-PDFTQLDLEMSFVE-VEDVLELNERLMAHVFREALGV-------------------ELPLPFPRLSYEEAMELLFVAGPRKVAATALGAVRLRAADLLGLKREGFRFLWVVDFPLYMHHPFTSPHPEDRVRALAYDLVLNGVEVGGGSIRIHDPRLQARVFRLLGIGEEEQRFGFFLEALEYGAPPHGGIAWGLDRLLALMTGSPSIREVIAFPKNKEGKDP 557
14 -93.0004ycv_A mol:protein length:516 Lysine--tRNA ligase  ali model follow..  18  20.....KDKGINPYPHKFERTISIPEFIEKYK-NGEHLEDTILNITGRIMRVSASGQKLRFFDLVGDGEKIQVLANYSFHNHEKGNFAECYDKIRRGDIVGIVGFPGKSKKG-------ELSIFPKETILLSACLHMLP---------------MKYGLKDTEIRYRQRYLDLINESSRHTFVTRTKIINFLRNFLNERGFFEVETPMMNLIAGGANARPFITHHLDLDLYLRIATELPLKMLIVGGIDKVYEIGKVFRNEGIDN-THNPEFTSCEFYWAYAD-YNDLIKWSEDFFSQLVYHLFGTYKISYNKDGPENQPIEIDF--TPPYPKVSIVEEIEIIKEHKIELPNPPTAAKLLDQLASHFIENKYNDKPFFIVEHPQIMSP-LAKYHRTKPGLTERLEMFICGKEVLNAYTELNDPFKQKECFKLQGDTEAAQLDSAFCTSLEYGLPPTGGLGLGIDRITMFLTNKNSIKDVILFPTMRPA... 507
15 -92.8005hgq_A mol:protein length:524 Lysine--tRNA ligase  ali model follow..  18  22.....RSKGINPYPHKFHVSISLADFIAKYN-KDVILNDIVQSVAGRVFSKRESGGKLIFYDLHGEGTRLQVLANARFHSG-DEAFDNLHDRIKRGDIIGVNGYPARSKSG-------ELSIIPYEIIQLTPCLHMLP--------------HTHFGLKNQETRYRMRYLDLMNPDVKNRFVTRSRMISFLRRYLDNLGFLEVETPMMNLIAGGATAKPFITHHLDMDLYLRVAPELYLKMLVVGGIDRVYEIGRVFRNEGIDQ-THNPEFTSCEFYMAYAD-YEDLMKITEDMLARMVYYMHGTYKIQYH--NGIVENPVYEVDFTPPFRKVNIYDGLQLAVENNVECPAPRTTARLLDKLIGEFLEPTF-ISPTFLTGHPQIMSP-LAKWHRSIPGLTERFELFVVTKEIVNAYTELNDPLTQRLRFDEQGDDEAQNIDENYCTALEYGLPPTAGWGMGIDRLAMILTDSNNIKEVLFFPAMRPD... 511
16 -90.8001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  19  2.......................................................................................................................................................................NAVEIISREISPTLDIQTKILEYMTDFFVKEGFKWLLPVIISPIPAGEGMEPAEVEIYGVKMRLTHSMILHKQLAIAMGLKKIFVLSPNIRLESKDDGRHAYEFTQLDFEVERAK-MEDIMRLIERLVYGLFRKAEEWTGREFPKTK--------------RFEVFEYSEVLEEFGS--------------------DEKASQEMEEPFWIINIPREFYDREVDGFWRN----YDLILPYGYGEVASGGEREWEYEKIVAKIRKAGLNEDS--FRPYLEIAKAGLKPSAGAGIGVERLVRFIVGAKHIAEVQPFPRIPGIPA. 292
17 -89.2006aqh_A mol:protein length:508 Lysine--tRNA ligase  ali model follow..  20  28.....LAQGRQPYPVDVPRTHTLLERQAYPDLPVDARTGEIVGVTGRVVFARNSGK-LCFATLQEGDGQLQAMISLAEVGQEALDNWK--TYVDIGDIVFVHGEVITSKRG-------ELSVLADSWQMAAKALRPLP---------------VAHKEMSEESRVRQRYVDLVRDQARKVARQRIAVMRAIRSALERRGFLEVETPMLQTLAGGAAARPFVTHSLDTELYLRIAPELFLKRCLVGGFERVFELNRVFRNEGADS-THSPEFVMLETYQAYGT-YDDSAVVTRELIQEVADEAIGTRQVPL--------PDGTVYDLDGEWESIQMYPSLSIADRLGLDIPRDRGYGHKLVEELWEHTVGAKLWAPTFVKDFPVETTP-LTRSHRSIPGVTEKWDLYVRRIELATGYSELTDPIIQRERFEAQGDDEAMALDEDFLAALEYGMPPSTGTGMGIDRLMMTLTG-LSIRETVLFPIVKPR... 502
18 -89.1003a74_A mol:protein length:493 Lysyl-tRNA synthetase  ali model follow..  21  20.....EELGVDPFGKRFERTHKAEELFE--SKEELEEQQIEVAVAGRIMTKRGMGK-AGFAHIQDVTGQIQIYVRQDDVGE---QQYELFKISDLGDIVGVRGTMFKTKVG-------ELSIKVSSYEFLTKALRPLP--------------EKYHGLKDIEQRYRQRYLDLMNPESKKTFITRSLIIQSMRRYLDSHGYLEVETPMMHAVAGGAAARPFITHHLDMTLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGIST-RHNPEFTMLELYEAYAD-FRDIMKLTENLIAHIATEVLGTTKIQYGEHLVDLTPEWRRLHMVDAIKEYSDEEARELAKEHGVEVAPHMTFGHIVNEFFEQKVEDKL-IQPTFIYGHPVEISP-LAKKNPDDPRFTDRFELFIVGREHANAFTELNDPIDQRQRFEEQGNDEAHEMDEDFLEALEYGMPPTGGLGIGVDRLVMLLTNSPSIRDVLLFPQMRHK... 493
19 -89.0005vl1_A mol:protein length:506 Lysine--tRNA ligase  ali model follow..  20  25.....LAEGYDPYPVAIERTHTLAERATYADLPTDSATEDIVGVAGRVVFARNTGK-LCFATLQDGDGQLQAMISLDEVGRESLDRWK--ADVDIGDVVYVHGTVISSRRG-------ELSVLADSWRMAAKALRPLP---------------VAHKEMSEESRVRQRYVDLVRPQAREVARQRIAVIRAVRNALERRGFLEVETPMLQTLAGGAAARPFVTHSLDIDLYLRIAPELFLKRCIVGGFDRVFELNRVFRNEGSDS-THSPEFSMLETYQTYGT-YDDSALITRELIQEVADEAIGTRQLSMP--------DGSVYDIDGEWATMEMYSSLSIASGLDVEIDNSVFGHGKLVEELWEHAVGNKLTAPTFVKDFPVETTP-LTRQHRSIPGVTEKWDLYVRGVELATGYSELNDPVVQRDRFADQGDDEAMQLDEDFLTALEYGMPPCTGTGMGIDRLLMCLTG-LSIRETVLFPIVRPH... 498
20 -88.4001e1o_A mol:protein length:504 LYSYL-TRNA SYNTHETASE, HEAT INDUCIBLE  ali model follow..  22  23EKLAALRQQGVAFPNDFRRDHTSDQLHE-KDNQELESLNIEVSVAGRMMTRRIMGK-ASFVTLQDVGGRIQLYVARDSLPE--GVYNDQFKKWDLGDIIGARGTLFKTQTG-------ELSIHCTELRLLTKALRPLP--------------DKFHGLQDQEVRYRQRYLDLANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVIPGGASARPFITHHLDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISV-RHNPEFTMMELYMAYAD-YHDLIELTESLFRTLAQEVLGTTKVTYGEHVFDF---------GKPFEKLTMREAIKLAESIGITVEKSWGLGRIVTEIFDEVAEAHL-IQPTFITEYPAEVSP-LARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAERFQEQGDDEAMFYDEDYVTALEYGLPPTAGLGIGIDRMIMLFTNSHTIRDVILFPAMRPQ... 503
21 -88.0004up7_A mol:protein length:777 LYSINE--TRNA LIGASE  ali model follow..  17  19.....QKAGHNPWPHKFNVSITVPEIAKYSGLEKSQVSDDIVSVAGRVLSKRSSSSALMFIDLHDSQTKLQIMLNKSAYEN-KEDFVSLTKMIYRGDICGFTGHPTRTKTG-------ELSLIPISGMILSPCLHMLP--------------SMHYGLGDQETRFRKRYLDLINPESVKNFVLRTKVVKAVRKYLDDKGFLEVETPILNTIPGGATARPFITHHLDIQMYMRIAPELYLKELVVGGINRVYEIGRLFRNEGIDQT-HNPEFTTCEFYMAYAD-YNDIMKMTEELLGNMVKDITGG--------STKLEIKDRLMDINNEEDIKMLEKFFKKMVLDFTAPFKRISYVHALEEKFGEKIPEVDLVQPTFVCDQPQLMSP-LAKYHRSEPELTERFELFILKREIANAYTELNNPIVQRSNFEQQGDDEAQLVDEVFLDAIEHAFPPTGGWGLGIDRLAMLLADVDNIKEVILFPTMRPE... 564
22 -87.7003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein  ali model follow..  20  2.......................................................................................................................................................................NAVEIISRDIYKAIDIQTKILDYMTKFFTDRGFKWLLPIMLSPIPAGEGIRPAEVDVYGVRMRLTHSMILHKQLAIAMGLEKIFVLSPNIRLESKDDGRHSYEFTQLDFEIEGAK-MKDVMRLIEELIYGLFRKAEEWTGREFPRAR--------------HFKVYDYKDILEEFGS--------------------DEKASMEMEEPFWIVNIPREFYDREE----NGVWKNYDLILPYGYGEVSSGGEREWEYEKIVAKIRAAGLKEDS--FRPYLEIARAGLKPSAGAGIGVERLVRFIVGAKHIAEVQPFPRVPGIPAV 293
23 -87.5004wj3_M mol:protein length:599 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  23  4........................MRSHYCGQLNESLDGQEVTLCGWVHRRRDHGG-VIFLDVRDREGLAQVVFDPD-----RAETFAKADRVRSEFVVKITGKVRLRPEGARNPNSGSIEVLGYELEVLNQA-ETPPFPLDE------------YSDVGEETRLRYRFIDLRRPEMAAKLKLRARITSSIRRYLDDNGFLDVETPILGRPTPEGARDYLVPSR-GHFFALPQSPQLFKQLLMVAGFDRYYQIAKCFRDEDLRADRQ-PEFTQIDIETSFLD-ESDIIGITEKMVRQLFKEVLDVEFDEFPHMPFEEAMRRYGSDKPDLRIPLELVDVADQLKEVDKAKIVCDALGALRIKVGHDLKLLTREWAPMWVVDFPMPKCTPAELEANPGAALSRAYDMVLNGTELGGGSIRIHDKSMQQAVFRVLGIAEQEEKFGFLLDALKYGAPPHGGLAFGLDRLVMLMTGASSIREVIAFPKTQSAGDV 566
24 -87.4001bbu_A mol:protein length:504 PROTEIN (LYSYL-TRNA SYNTHETASE)  ali model follow..  20  23EKLANLREQGIAFPNDFRRDHTSDQLHA-KENEELEALNIEVAVAGRMMTRRIMGK-ASFVTLQDVGGRIQLYVARDDLPE--GVYNEQFKKWDLGDILGAKGKLFKTKTG-------ELSIHCTELRLLTKALRPLP--------------DKFHGLQDQEARYRQRYLDLSNDESRNTFKVRSQILSGIRQFMVNRGFMEVETPMMQVIPGGAAARPFITHHLDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISV-RHNPEFTMMELYMAYAD-YKDLIELTESLFRTLAQDILGKTEVTYGDVTLDFGKPFEKLTMREAIKKYNFDSAKAIAESIGIHVEKSWGLGRIVTEIFEEVAEAHL-IQPTFITEYPAEVSP-LARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAQRFLDQGDDEAMFYDEDYVTALEHGLPPTAGLGIGIDRMVMLFTNSHTIRDVILFPAMRPV... 503
25 -87.0006chd_A mol:protein length:597 Lysine--tRNA ligase  ali model follow..  19  88.....KVNGEDPYPHKFHVDISLTDFIQKYS-PGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKS-EEEFIHINNKLRRGDIIGVQGNPGKTKKG-------ELSIIPYEITLLSPCLHMLP--------------HLHFGLKDKETRYRQRYLDLLNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHLDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDL-THNPEFTTCEFYMAYAD-YHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGQAYDVDF--TPPFRRINMVEELEICVAKAVECPPPRTTARLLDKLVGEFLEVTC-INPTFICDHPQIMSP-LAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPE... 576
26 -86.7004ex5_A mol:protein length:529 Lysine--tRNA ligase  ali model follow..  20  39DKLRALRDQGIAYPNDFQPTHHAADLQT-ADKEALEAKSLEVAIAGRMMLKRVMGK-ASFATVQDGSGQIQFFVTPADVGA---ETYDAFKKWDLGDIVAARGVLFRTNKG-------ELSVKCTQLRLLAKALRPLP--------------DKFHGLADQETRYRQRYVDLVTPETRTTFRARTKAIASIRKFMGDADFMEVETPMLHPIPGGAAAKPFVTHHLDMEMFLRIAPELYLKRLIVGGFERVFEINRNFRNEGVSP-RHNPEFTMMEFYAAYTD-YRWLMDFTERLIRQAAVDALGTATIQYQGRELDLAQPFHRLTITQAIQKYDDAFLRSELKRLGVDVTQPAFLNAGIGALQLALFEEAQLWEPTFIIDYPIEVSP-LARESDTVAGITERFELFITGREIANGFSELNDPEDQAARFKKQGDEEAMFFDADYIRALEYGMPPTGGCGIGIDRLVMLLTDSPTIRDVLLFPHLRRE... 522
27 -86.5005w25_A mol:protein length:616 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  22  1..MGSSSSGLVPRGSHVFV-----LRSHAAGLLREGDAGQQVTLAGWVARRRDHGG-VIFIDLRDASGIAQVVFRDPQ----DTEVLAQAHRLRAEFCVSVAGVVEIRPEGNANPETGEIEVNATSLTVLGEC-APLPFQLDE--------------PAGEELRLKYRYLDLRRDDPAAAIRLRSRVNAAARAVLARHDFVEIETPTITRSTPEGARDFLVPARLHPGSFLPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQ-PEFTQLDMEMSFVD-AEDIIAISEEVLTELWALIGYRIPTPIPRIGYAEAMRRFGTDKPDLRFGLELVECTDFFSDTTFRVFQAPYVGAVVMPGGASQPRRTLDGAFVWVVDPPLAVHHAFTAPKPEWEDRADAYDIVCNGHEIGGGSVRIHRRDIQERVFAVMGLDKAEEKFGFLLEAFMFGAPPHGGIAFGWDRTTALLAGMDSIREVIAFPKTGG.... 578
28 -84.9004rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  23  3.........................RTHAAGSLRPADAGQTVTLAGWVARRRDHGG-VIFIDLRDASGVSQVVFREG-------DVLAAAHRLRAEFCVAVTGVVEVRPEGNENPETGQIEVNATELTVLGES-APLPFQLDE--------------QAGEEARLKYRYLDLRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTLTRSTPEGARDFLVPARLGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQ-PEFTQLDMEMSFVE-ADDVIAISEQVLKAVWATIGYDLPLPLPRISYEEAMRRFGSDKPDLRFGIELVECTEYFKDTTFRVFQAPYVGAVVMPGGASQLIDPNAWAFTWVVDFPTAMHHAFTAPKPDSNALSDAYDIVCNGNEIGGGSIRIHRRDIQERVFAMMGIDEAQEKFGFLLDAFSYGAPPHGGIAFGWDRITALLAGVDSIREVIAFPKSGGGVDP 563
29 -84.7004ah6_A mol:protein length:617 ASPARTATE--TRNA LIGASE, MITOCHONDRIAL  ali model follow..  20  2.........IPEFSSFVVRTNTCGELRS-------SHLGQEVTLCGWIQYRRQNT----FLVLRDFDGLVQVIIPQD---ESAASVKKILCEAPVESVVQVSGTVISRPAGQENPKTGEIEIKVKTAELLNACKK-LPFEIKN------------FVKKTEALRLQYRYLDLRSFQMQYNLRLRSQMVMKMREYLCNLGFVDIETPTLFKRTPGG-AKEFLVREPGKFYSLPQSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQ-PEFTQIDIEMSFVD-QTGIQSLIEGLLQYSWPNDKDPVVVPFPTMTFAEVLATYGTDKPDTRFGMKIIDISDVFRNTEIGLNANRNWNSPVANFIMESQRLELIRSFLWVVDFPLHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILATLL-KEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFRGHDL 574
30 -83.8004o2d_A mol:protein length:620 Aspartate--tRNA ligase  ali model follow..  23  27.................................RPADAGQTVTLAGWVARRRDHGG-VIFIDLRDASGVSQVVFREG-------DVLAAAHRLRAEFCVAVTGVVEVRPEGNENPETGQIEVNATELTVLGES-APLPFQLDE--------------QAGEEARLKYRYLDLRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTLTRSTPEGARDFLVPARLQPGSFLPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQ-PEFTQLDMEMSFVE-ADDVIAISEQVLKAVWATIGYDLPLPLPRISYEEAMRRFGSDKPDLRFGIELVECTEYFKDTTFRVGEDGTLGGPVAKNLSDAERDGLAMHHAFTAPKPDSVDT---FDSDPGNALSDAYDIVCNGNEIGGGSIRIHRRDIQERVFAMIDHDEAQEKFGFLLDAFSYGAPPHGGIAFGWDRITALLAGVDSIREVIAFPKSGG.... 575
31 -83.0001eqr_A mol:protein length:590 ASPARTYL-TRNA SYNTHETASE  ali model follow..  20  2.........................RTEYCGQLRLSHVGQQVTLCGWVNRRRDLGS-LIFIDMRDREGIVQVFFDPD-----RADALKLASELRNEFCIQVTGTVRARDEKNINRDTGEIEVLASSLTIINRA-DVLPLDSNH--------------VNTEEARLKYRYLDLRRPEMAQRLKTRAKITSLVRRFMDDHGFLDIETPMLTKATPEGARDYLVPSRVGKFYALPQSPQLFKQLLMMSGFDRYYQIVKCFRDEDLRADRQ-PEFTQIDVETSFMT-APQVREVMEALVRHLWLEVKGVDLGDFPVMTFAEAERRYGSDKPDLRNPMELTDVADLLKSVEFAVFAGPANDPKGRVAMFEDDGEGGLTAMHHPFTSPKDM-TAAELKAAPENAVANAYDMVINGYEVGGGSVRIHNGDMQQTVFGIINEEEQREKFGFLLDALKYGTPPHAGLAFGLDRLTMLLTGTDNIRDVIAFPKTTAAACL 563
32 -69.9003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  15  1...........................................................................................................................................................MGSSSSGLVPRGSHMSEQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQAVTDIHLVPFETRFQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGR-YHNPEFTMLEWYRPHYD-MYRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPL---------SADKTQLREVAAKLDLSADTEEDRDTLLQLLFTFGVEPNIGEKPTFVYHFPASQAS-LAQISTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDRGLPQHPIDQNLIEALKVGMPDCSGVALGVDRLVMLALGAETLAEVIAFSVDRA.... 339
33 -68.5003g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  16  9............................................................................................................................................................................QPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQAVTDIHLFPFETRFQGINLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMGR-HHNPEFTMLEWYRPHYD-MYRLMNEVDDLLQQVLDCQPAESLSYQQAFQRHLEIDPLSADKTQLREAAA--------LDLSNIADTEEDRDTLLQLLFTMGVEPHIGKKPTFIYHFPASQAS-LAQISTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDRGLPQQPIDQNLLDALAAGLPDCSGVALGVDRLVMLALGAESLADVIAFTVDRA.... 326
34 -65.9004lns_A mol:protein length:351 Asparagine synthetase a  ali model follow..  17  3.....................................................................................................................................................................DDGYSSYV-LLQEQILTVKRSFSEALEKEL---NLVEVRAPILFRVGDEKAVQVPVKAIPNASFEVVHSLAKWKRRTLFAPGHGLYTHMTALRVDDVLDNIHSVVVDQWDWEMVMKD-DQRNLAFLKEVVCKVYAAIRKTELAVCEKYKQKPILPETAEHLLLAYPNLTAKEREREIREYGAVFLIGIGAVLSSGDRHDARAPDYDSPVEASQVVFPRTSKPIPTMNSLSNGDILLYNPTLDDSLEVSSMGIRVNAEALRHQISLTGDDSLLK--SEWHQQLLNGEFPQTVGGGIGQSRMVMFMLRKKHIGEVQVWPEEIRKKHN 349
35 -63.50011as_A mol:protein length:330 ASPARAGINE SYNTHETASE  ali model follow..  14  3.........................................................................................................................................................................TAYI-AKQRQISFVKSHFSRQLEERL---GLIEVQAPILSRVGAEKAVQVKVKALPDAQFEVVHSLAKWKRQTLFSAGEGLYTHMKALRDEDRLSPLHSVYVDQWDWERVMGD-GERQFSTLKSTVEAIWAGIKATEAAVSEEFGLAPFLP-------DQIHFVHSQELLSRYPDLDAK-GRERAIAKDLGAVFLVGIGGKLSDGAPDYDDWSTPSELGHAGLNGD---ILVWNPVLEDAFELSSMGIRVDADTLKHQLALTGDEDRLE--LEWHQALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVGVWPAAVRESVP 327
36 -33.4002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  14  3......................................................................................SSSSGLVPRGSHMFLTRRDPPLSTKVQYQRLKELNASGEQLEMGFSDALSRD--------------RAFQGIEHQLMSQGKRHLELRTVKHRPAL---LELEEKLAKALHQQGFVQVVTPTIITKSTIGEDHPLFSQVLDGKKCLRLAPNLYTLWRLWDKPIRIFEIGTCYRKESQGA-QHLNEFTMLNLTELGTP-LEERHQRLEDMARWVLEAA-----REFELVTESSVVYGDTVDVMKGDLELASGAM-HFLDEKWEIFDPWVGLGFGLERLLMIREGTQSMARSLSYLDGVR........................................................................................................... 298
37 -32.3004gn5_A mol:protein length:113 OBody AM3L15  ali model follow..  18  4........................KKTHWTAEITPNLHGSEVVVAGWVAHLGDYGR-VKIVKVSDREGGAAVPVYLER-GKTPDHLFKVFAELSREDVVVIKGIVEAGWPVALD---TGVEIFPSEIWILNKA-KPLPID.............................................................................................................................................................................................................................................................................................................................................................. 113
38 -32.0004gn4_B mol:protein length:108 OBody AM2EP06  ali model follow..  16  4.......................PKKTHWTAEITPNLHGSEVVVAGWVAHLGDYGR-VKIVKVSDREGGAAVPVYLER-GKTPDHLFKVFAELSREDVVVIKGIVEASEQYGSA---TGVEIFPSEIWILNKA..................................................................................................................................................................................................................................................................................................................................................................... 108
39 -31.7004glv_B mol:protein length:107 OBody AM3L09  ali model follow..  16  4........................KKTHWTAEITPNLHGSEVVVAGWVAHLGDYGR-VKIVKVSDREGGAAVPVYLER-GKTPDHLFKVFAELSREDVVVIKGIVEATTVTRWD---TGVEIFPSEIWILNKA..................................................................................................................................................................................................................................................................................................................................................................... 107
40 -31.6004gn3_B mol:protein length:113 OBody AM1L10  ali model follow..  15  3...................GSVYPKKTHWTAEITPNLHGTEVVVAGWVASLGDYGR-VKIVKVSDREGGAAVSVYLEY-GKTPDHLFKVFAELSREDVVVIKGIVEASKAAADMHN--GVEIFPSEIWILNKA..................................................................................................................................................................................................................................................................................................................................................................... 112
41 -31.0004gla_C mol:protein length:109 OBody NL8  ali model follow..  16  5.......................PKKTHWTAEITPNLHGTEVVVAGWVASLGDYGR-VKIVKVSDREGGAAVPVYLEA-GKTPDHLFKVFAELSREDVVVIKGIVEASKG-----VGRGVEIFPSEIWILNKAKA................................................................................................................................................................................................................................................................................................................................................................... 109
42 -28.9005gro_A mol:protein length:115 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  17  15.................................SEKDVGKIVKVAGWCNTYRDHGG-VVFIDLRDKSGLVQLVCDPS------SKAYEKALEVRSEFVLVAKGKVRLRGAGLENPKTGKIEIVLEELIIENKS..................................................................................................................................................................................................................................................................................................................................................................... 109
43 -26.2004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  15  5................................................................................................................SSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAE--ERENYLGKLEREITRFFVDRGFLEIKSPILIPLEGIDNDTELSIFRVDKNFCLRLYNYLRKLDRALPDPIKIFEIGPCYRKESDGK-EHLEEFTMLSFIQMGSGTRENLESIITDFLNHLGID---------------------------------------------------------------------------------------FKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLD------REWGID-----------------KPWIGAGFGLERLLKVKHDFKNIKRA............ 271
44 -25.4002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  15  5................................................................................................................SSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAE--ERENYLGKLEREITRFFVDRGFLEIKSPILIPLEGIDNDTELSIFRVDKNFCLRPMLAPNLYNYLLPDPIKIFEIGPCYRKESDGK-EHLEEFTMLNFCQMGSGTRENLESIITDFLNHL------------------------------------------------------------------------------------------FKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLD------REWGIDK-----------------PWIGAGFGLERLLKVKHDFKNIKRA............ 271
45 -23.4004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  11  3......................................................................................SSSSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLN------------------------SGKPFRELESELLSRRKKDLQQIYAE--ERENYLGKLEREITRFFVDRGFLEIKSPILIPLEGIDNDTELSKQIFDKNFCLRPMLAPNLGNYLRKLDRKIFEIGPCYRKESDGK-EHLEEFTMLNFCQMGSGC---TRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPRPLDREWGID---------------------------KPWIGAGFGLE-RLLKVKHDFKNIKRAARSESYYNGIST.............................................................................. 283
46 -23.2005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  18  23......................................................................................................................................................SLNSGKPFRELESELLSRRKKLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEGIDNDTELSKQIFRVDKNFCLRPMLRKLDRALPDPIKIFEIGPCYRKESDGK-EHLEEFTMLAFAQMGSGTRENLESIITDFLNHLGID---------------------------------------------------------------------------------------FKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLD------REWGIDK-----------------PWIGAGFGLERLLKVKHDFKNIKRA............ 254
47 -21.4004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  17  17.................................................................................................................................................PKDEISLNSGKPFRELESELLSRRKKLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEDNDTELSKQIFRVDKNFCLRVAPNIFNYARKLDR--KIFEIGPCYRKESDGKE-HLEEFTMLNFFQMGSGTRENLESIITDFLNHL------------------------------------------------------------------------------------------FKIVGDSCSVYGDTLDVMHGDLELSSAVV------GPIPLDREWGIDK-----------------PWIGAGFGLERLLKVKHDFKNIKRA............ 253
48 -18.7003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  12  10........................................................................................................................SHGASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKK--DLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEGIDNDTELSKQIFRVDKNFCLRPMLTPNLYNY----KIFEIGPCYRKESDGK-EHLEEFTMLVFWQMGSGCRENLESIITDFLNHL................................................................................................................................................................................................ 198
49 -17.1004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  13  1........................................................................................................................................MPLTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLENYLGKLEREITRFFVDRGFLEIKSPILIPLEIDNDTELSKIFRVDKNFCLRPMLAPNLANYLRKLDRKIFEIGPCYRKESDG-KEHLEEFTMLNFCQMGSGCRENLESIITDFLNHL................................................................................................................................................................................................ 184
50 -12.8002rhq_A mol:protein length:294 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  11  1.................................................................................................................................MGSSSSGLVPRGSHMGTELMEKLNQQLAEETIDVTLPSRQISIGSKH--------TRTVEEIEDLFLGLGYEIVDGYEVEQDKSHPARDMQDSFYITDEILMRTHTSPVQARTMEKRNGKIICPGKVYRRDSDDAT-HSHQFTQIELVVDKNIKMSDLKGTLELVAKKLF----------------------------------------------------------------GADREIRLRPSYFPFTEPSVEVDVSCFKCKGKGCNVCKHTGWI----EILGAGM------VHPNVLEMAGFDSNEYS----------------AFGMGPDRIAMLKYGIEDIRYF............ 269
51 -12.6003l4g_A mol:protein length:508 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  11  45.......................QALGEVIEAELRSTKHWELTAEGEEIAREGSHEARVFRSIPPEGLAQSELMRLPS-GKVGFSKAMSNKWIRVDKSAADGPRVFRVVDSMEDEVQRRLQLVRGGQAEKLGEKERSELRKRKLLAEVTLKTYWVSKGSAFSTSISKQETELSPEMISS-----LKVRSQFRQIFLEMGFTEMPTDALFQPQQHPARDQHDTFFLRDPAEALQLPMDYVQRVKRTHSQKYFSIDRVFRNETLDAT-HLAEFHQIEVVADHGLTLGHLMGVLREFFTKLGIT--------------------------------------------------------------------------------QLRFKPAYNPYTEPSMEVFSYHQGLKKWVEVGNSGV------FRPEMLLPMGLPENVSVI---------------AWGLSLERPTMIKYGINNIREL............ 477
52 -12.6004p71_C mol:protein length:338 Phenylalanine--tRNA ligase alpha subunit  ali model follow..  11  3....................................................................NLDALVSQALEAVRHTEDVNALEQIRVH-YLGKKGELTQVMKTLGDLPAEERPKVGALINVAKEKVQDVLNARKTELEGAALAARLAAERIDVTLPGRGQLSGGLHP---------TRTLERIEQCFSRIGYEVAEGPEVEDDGHHPARAMHDTFYFNANMLLRTHTSPVQVRTMESQQPRIVCPGRVYRCDSDLT--HSPMFHQVEGLLVDEGSFADLKGTIEEFLRAFFEK-----------------------------LEVRFRPSFFPFTEPSAEVDIQCVICSGNGCRVCKQTG------------------------------------------EVMGCGM------VHPNVLRMSNIDPEKFQ----------------AFGMGAERLAMLRYGVNDLRLF............ 326
53 -12.1001b70_A mol:protein length:350 PHENYLALANYL-TRNA SYNTHETASE  ali model follow..  12  1........................................................................MLEEALAAIQNARDLEELKALKAR-YLGKKGLLTQEMKGLSALPLEERRKRGQELNAIKAALEAALEAREKALEEAALKEALERERVDVSLPGASLFSGGLHP---------TLMERELVEIFRALGYQAVEGPEVESEPARDMWDTFWLTGEGFRLEGPLGEEVEGRLLLRTHTSRIVVPGRVFRFEQTDAT-HEAVFHQLEGLVVGEGAMAHLKGAIYELAQAL------------------------------------------------------------------------------FGPDSKVRFQPVYFPFVEPGAQFAVWWPEGGKWLELGGAGM--------PKVFQAVDAYR---------ERLGLPPAYRGAFGLGVERLAMLRYGIPDIRYF............ 335
54 -12.0003pco_A mol:protein length:327 Phenylalanyl-tRNA synthetase, alpha subunit  ali model follow..  11  3....................................................................HLAELVASAKAAISQASDVAALDNVRVE-YLGKKGHLTLQMTTLRELPPEERPAAGAVINEAKEQVQQALNARKAELESAALNARLAAETIDVSLPGRRIENGGLHP---------TRTIDRIESFFGELGFTVATGPEIEDDGHHPARADHDTFWFDTTRLLRTTSGVQIRTMKAQQPPIRIIAPGRVYRNDYDQT-HTPMFHQMEGLIVDTNSFTNLKGTLHDFLRNFFEE-----------------------------LQIRFRPSY-----------------------------------------FP------FTEPSAEVDVMGKNGKWL----EVLGCGM------VHPNVLRNVGIDPEVYS----------------AFGMGMERLTMLRYGVTDLRSF............ 315
55 -11.8002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  13  26....................................................................................................................................................................................TAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYLTLRPEGCVRAGIEHGLLRLWYIGPMFRHERPQKGRY-RQFHQLGCEVFGLQG--ELIMLTARWWRAL--GISEHVTLELNSIGSLEARANYRDALVAFLEQHK-TNPLRVLDSKNPEVQALLNDAPALGDYLDEESREHFAGLCKLLESAGIAYT---------NQRLVRGLDYYNR-------------FEWVTNSLGSQGTVCAGGRYDGLVEQLGGRATPAVGFAMGLERLVLLV..................... 323
56 -11.8005e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  11  20....................................................................................................................................................................................TAAWRRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRAIGDATDIVEKEMYLTLRPEGCVRALVEHNLLRVWYMGPMFRYEKPQKGRY-RQFHQFGVETFGVAT--ELIMLTARLWKRM--GVDHMVQLELNTLGETDERTEYRNALVAFLNEHK-TNPLRILDSKIESTQKILENAPKLHDFLKEDSLSHFQQLQDYLTAAGIKFV---------NQKLVRGLDYYNK-GTVCAGGR----YDGLVGQLKGKADQS----------------VPAVGFAMGMERLLLLL..................... 322
57 -11.7003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  13  1...........................................................................................................................................................SNAMAKNDKINFSTPSGFPEFLPSEKRLELYLLDTIRRVYESYGFTPIETPVLQAKGNQGDNIIYGLEPISEARALKFDQTVPLAAYIARHLNARYQMDVVFRGERAKDGRF-RQFRQCDIDVVGREKLSLLYDAQMPAIITEIFEAVNIGDFVIRINNRKVLTGFFQSLNISETQIKSCISIIDNLEKIGEAKVKLELEKEGINPEQTQKIIDFVKID---VLDKLKHLSQTLPESEQFNLGVSELETVIARGLNYYTGTV----YETTLIGHEALGSICSGGRYEELVGTFIGEKMPGVGISIGLTRLISRLLKAGILNTL............ 367
58 -11.6004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  13  9.................................................................................................................RRQMAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKSPRQMAVREKVFDVIIRCFKRHGAEVIDTPTLMGKYGEDSKLIYDLK--GELLSLRYDLTVPFARYLAMN--KRYHIAKVYRRDNPAMTRRYREFYQCDFDIAGNFD--ECLKIMCEILSSL-----QIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWE------------------VKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEG--LGDLKLLFEYLTLFGIDDKISFDLSLARGLDYG-VPCVGLSIGVERIFSIV..................... 404
59 -11.6003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  11  37....................................................................................................................................................................................AKRRRAVETRLLSFVEDAGYEPVTSGLFEARSPESSRDWIRLDGGGDAVALRPEMTPSIARMAAPRVARWCYCERVYRRTDDPASLKAAESTQVGIERIGEEA--DVLRLLHEASAAA-----GVRHHRIVVSHARLVPRLLDALGISASLSRAFLACLTSGNYVQFR------------ELWQLHAAKDVDLLANLLTWSPAERDAAKRSREASDRELEALLRDAVDPRAAADVRDAWRYLCRLAEALHDSGLASDVVTFDYYTGLVQFGAGPAVGFAFEVERVMAVLEAQEEGEGEC........... 373
60 -11.5003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  12  37....................................................................................................................................................................................MRCRRHLFDVFHATAKTFGFEEYDAPVLEKAGEEITEQMFNFI--GHRVALRPEMTPSLARLLLGK--KWYSIPQCWRYEAITRGRR-REHYQWNMDIVGVKSVSELVCAACWAMRSL--NSRKVLQTVVEQAGVTSDKFAPVCVIVDKMEKIPREEVEAQLAVLGLEPTVVDAITTTLSLKSIDEIAQRVGEEHEAVKELRQFFEQVEAYGYGDDASVVRGLAYYTG-RALCGGGR----YDNLLTTYGSPT-------------------IPCAGFGFGDCVIVELLQEKRLLPDI............ 352
61 -11.4001qe0_A mol:protein length:420 Histidine--tRNA ligase  ali model follow..  12  16....................................................................................................................................................................................SKKWRYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSTDVVQKEMYITLRPEGVVRSYIEHKMQKLYYNGPMFRYERKQKGRY-RQFNQFGVEAIGAEN--EVLAMVMHIYQSF----LKHLKLVINSVGDMASRKEYNEALVKHFEPVI-TDPMRILDCKVDRDKEAIKTAPRITDFLNEESKAYYEQVKAYLDDLGIPYT---------DPNLVRGLDYYTH--ELMMDNPNYD---------GAITTLCGGGRYNGLLELLDGPSETGIGFALSIERLLLAL..................... 317
62 -11.3003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  12  37....................................................................................................................................................................................MRLRKYLFDVFHSTARKFGFEEYDSPVLESEERKAGEEITEQMF-GHRVALRPEMTPSLARQLLAK--KWYSIPQCWRYEAITRGRR-REHYQWNMDIIGVKSVSELVCAACTAMQSL----RKILQTVVEQAGVSADKFAPVCVIVDKMEKLPREEVVAQLAAIGLESNVVDAITSTLSLKTIDEIAQRIGEEHEAVRELRDFITQIEAYGFGDDASVVRGLAYYTG-RALCGGGR----YDNLLTTYGSPT------------------AVPCVGFGFGDCVIVELLNEKKLLPE............. 351
63 -11.2004rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  15  19....................................................................................................................................................................................LRMHQRIVATARKVLEAAGALELVTPIFEETQVFEKGVGAATDIVRKEMFLTLRPEGMVRAYLEHGMKRLWMAGPMFRAERPQKGRY-RQFHQVNYEALGSENPILDAEAVVLLYECLKELGLRRLKVKLSSVGDPEDRARYNAYLRE------LSPHREALSEDSKERLELNPMRILDSKSERDQALLKELGVRPMLDFLGEEARAHLKEVERHLERLSVPYELLVRGLDYYVRTA----FEVHHEEIGAQSALGGGGRYDGLSELLGGPRVPGVGFAFGVERVALAL..................... 318
64 -11.1001nnx_A mol:protein length:109 Protein ygiW  ali model follow..  12  19...................QGPNGSVTTVESAKSLR-DDTWVTLRGNIVERISDDL----YVFKDASGTINVDIDHKRWNGVT---------VTPKDTVEIQGEVDK--------DWNSVEIDVKQIRKVNP...................................................................................................................................................................................................................................................................................................................................................................... 109
65 -11.1001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  12  20....................................................................................................................................................................................MDVEKFIFKTAEEAAEAFGFRRIDFPSLEYLDIKSGEELLQQTY-GREVTLIPEATPSTVRMVTSR--RWYSFPKVWRYEEPQAGRY-REHYQFNADIFGSDSPEADAEVI-ALASSILDRLGLQDIYEIRINSRKIMEEIIGGMTSSD--PFSVFSIIDRYHKISREEFVDQLRSAGIGEDGVSMIADLCSGTRGIDEMARIRMAAVEDLLASYGVKNVRYDFSIVRGLSYYTGIVEAYDRSGQFRAILGGG------RYDNLASLMSGESVPAVGFGMGDAVISLLL..................... 321
66 -10.9004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  12  40....................................................................................................................................................................................AGLWEFFEATVKSLLRAYGYQNIRTPIVEHTPLFTRGIGEVTDIVEKEMYLTLRPENVVRAAIEHNMLRLWYIGPMFRHERPQRGRY-RQFHQVGVEALGFAG--EIVMMCQRLWEDL----LTGIKLEINSLGLAEERAAHRVELIKYLEQHA-TNPLRVLDTKNPALQEIVRNAPKLIDFLGDVSRAHFEGLQRLLKANNVPFT---------NPRLVRGLDYYNL-------------FEWVTDKLGAQGTVAAGGRYDPLIEQLGGKPTAACGWAMGIERILELLKEEHLVPE............. 345
67 -10.8004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  13  4............................................................................................................................................................SEFELRRQFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFMGKYGEDSKLIYDLK--GELLSLRYDLTVPFARYLAMN--KRYHIAKVYRRDNPAMTRRYREFYQCDFDIAGNFD--ECLKIMCEILSSL-----QIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWE------------------VKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEG--LGDLKLLFEYLTLFGIDDKISFDLSLARGLDYG-VPCVGLSIGVERIFSIV..................... 351
68 -10.5003od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  11  24....................................................................................................................................................................................YKTKKNICDQMTEEINLWGYDMIETPTLEVVSAILDQQLFKLDQQGNTLVLRPDMTAPIARLVASSLKRLAYQSNVYRAQQNEGGKP-AEFEQLGVELIGDGTASEVIALMIAALKRA--VGNEQRADRLRRFLYEKNYVGYREHVKSLNLSTIDKSRLMNLLSLRGGRAAIEEARGLIQTEKGKTALAEMTKLYEVLESYGASEYVKF------DLTLVLHMSYYTGGVPLCSGGR----YDELLSKF---------------------RPAQATGFGVRIDLLVEAL..................... 327
69 -10.3001usy_A mol:protein length:275 ATP PHOSPHORIBOSYLTRANSFERASE REGULATORY SUBUNIT  ali model follow..  13  4......................................................................................................................................................................................LDFEKVFSFYSKATKKGFSPFFVPALEKA------EEPAGNFFRKGNLFSIREDFTKTVLNHRKRYKVWYADFVYRYSGSDLV----AEYQLGLEKVPRNSLDDSLEVLEIIVESASEFFEGPVIVEIGHTGYEDLLKEIPKDLHEKVLNLIDTKNLAEIEFLSHMKKIDLSRVEKIIEDSIYRRSPEHLKTMDLPLSVREDLLSASSFLQEKFPTVSVEIDLLARTIEEYCGLIFTIYDTSSSRLVAAGG---------------EYTGEKGVGGSIFLEGKT........................ 274
70 -10.2003kf8_A mol:protein length:220 Protein stn1  ali model follow..  86.......................................NQINIFGKIVYEQYKEESYVILVISDFIGIDSKIRVRLSQEQFKEVGLT-LDKKNYGKIVELEGEIYNWYDSINVSKKPDRELKVSKITVLSHRPDGL----------------------HFEFEQWKKRMEFRKNNLVEPWVFIPTPQR............................................................................................................................................................................................................................................................................................................. 219
71 -10.0006FTT Entity 1(prereleased)  ali follow..  11  15....................................................................................................................................................................................AHKQEVLRHQLTQQLITHGYQLVSPPMISGASEDLKRQTFKIIDQLTGRLMGIRADITPQILRIDAHHRYCYAGDVIHTLPSGLFGS-RTPLQLGAEIFGCESIAELIDVLFSMINSLMSAVLHVDLGHVTIFKRLAELAALSASDTEQLMQLYANKNLPELKQVCQVLPMGSDFYANLLGRLSENAQQDTKIVTAILQRLKAHLQVQWQCAVSIDVTELSGYHYHTGTQPLVRGGR----FDGMKSNQLATNQPR-----------------QATGFSMDVSRLLAHT..................... 319
72 -10.0005m8h_A mol:protein length:388 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  11  15....................................................................................................................................................................................AHKQEVLRHQLTQQLITHGYQLVSPPMISGASEDLKRQTFKIIDQLTGRLMGIRADITPQILRIDAHHRYCYAGDVIHTLPSGLFGS-RTPLQLGAEIFGCESIAELIDVLFSMINSLMSAVLHVDLGHVTIFKRLAELAALSASDTEQLMQLYANKNLPELKQVCQVLPMGSDFYANLLGRLSENAQQDTKIVTAILQRLKAHLQVQWQCAVSIDVTELSGYHYHTGTQPLVRGGR----FDGMKSNQLATNQPR-----------------QATGFSMDVSRLLAHT..................... 319
73 -9.9504gnx_B mol:protein length:136 Putative uncharacterized protein  ali model follow..  16  37.......................................GQLTFVAVVRNISRNATNVAY-SVEDGTGQIEVRQWLDSSSDDSSK----ASEIRNNVYVRVLGTLKSFQ--------NRRSISSGHMRPVIDYNE................................................................................................................................................................................................................................................................................................................................................................... 119
74 -9.9003kf6_A mol:protein length:159 Protein stn1  ali model follow..  11  48.......................................RWIQIVGYIAAIDIYEGKHVL-TVDDCSGMVLRVV----IIQDDFSMSKRAISMSPGNVVCVFGKINSFR--------SEVELIAQSFEELRDPNDEW................................................................................................................................................................................................................................................................................................................................................................. 133
75 -9.7401z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  14  30....................................................................................................................................................................................VKSLRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGKTFNQEKMFITLRYDFTLPLVRLYS--RYSYFGKIFRKEKRHKGRS-TENYQIGIELFGESADKSELEILSLALQVIEQLGLNKTVFEIGSAKFFQRLCQLADGSTELLTELLLKKDLSGLNAFIEKNNFSKELRSRLENLVTNTKDDVLISSFDQLKEFSEKLS--MIKPIIIDLGMVPKMDYYTDNQPILSGGR----YDQLLSNF---------------------EEAFAIGFCCHMDTILKAL..................... 328

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 1 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24