current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 1b76_A mol:protein length:442 Glycine--tRNA ligase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440
# Score Template Links and tools%idFirst AASSLDELVALCKRRGFIFQSSEIYGGLQGVYDYGPLGVELKNNLKQAWWRRNVYERDDMEGLDASVLTHRLVLHYSGHEATFADPMVDNAKARYWTPPRYFNMMFQDLRGPRGGRGLLAYLRPETAQGIFVNFKNVLDATSRKLGFGIAQIGKAFRNEITPRNFIFRVREFEQMEIEYFVRPGEDEYWHRYWVEERLKWWQEMGLSRENLVPYQQPPESSAHYAKATVDILYRFPHGSLELEGIAQRTDFDLGSHTKDQEALGITARVLRNEHSTQRLAYRDPETGKWFVPYVIEPSAGVDRGVLALLAEAFTREELPNGEERIVLKLKPQLAPIKVAVIPLVKNRPEITEYAKRLKARLLALGLGRVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSKDGTTRLKDTVTVRDRDTMEQIRLHVDELEGFLRERLRWLast
1 -152.0001b76_A mol:protein length:442 Glycine--tRNA ligase  ali model  100  1AASSLDELVALCKRRGFIFQSSEIYGGLQGVYDYGPLGVELKNNLKQAWWRRNVYERDDMEGLDASVLTHRLVLHYSGHEATFADPMVDNAKARYWTPPRYFNMMFQDLRGPRGGRGLLAYLRPETAQGIFVNFKNVLDATSRKLGFGIAQIGKAFRNEITPRNFIFRVREFEQMEIEYFVRPGEDEYWHRYWVEERLKWWQEMGLSRENLVPYQQPPESSAHYAKATVDILYRFPHGSLELEGIAQRTDFDLGSHTKDQEALGITARVLRNEHSTQRLAYRDPETGKWFVPYVIEPSAGVDRGVLALLAEAFTREELPNGEERIVLKLKPQLAPIKVAVIPLVKNRPEITEYAKRLKARLLALGLGRVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSKDGTTRLKDTVTVRDRDTMEQIRLHVDELEGFLRERLRW 442
2 -132.0001ati_A mol:protein length:505 GLYCYL-TRNA SYNTHETASE  ali model follow..  97  1AASSLDELVALCKRRGFIFQSSEIYGGLQGVYDYGPLGVELKNNLKQAWWRRNVYERDDMEGLDASVLTHRLVLHYSGHEATFADPMVDNRITKKRYRLDHFNMMFQDLRGPRGGRGLLAYLRPETAQGIFVNFKNVLDATSRKLGFGIAQIGKAFRNEITPRNFIFRVREFEQMEIEYFVRPGEDEYWHRYWVEERLKWWQEMGLSRENLVPYQQPPESSAHYAKATVDILYRFPHGSLELEGIAQRTDFDLGSHTKDQEALGITARVLRNEHSTQRLAYRDPETGKWFVPYVIEPSAGVDRGVLALLAEAFTREELPNGEERIVLKLKPQLAPIKVAVIPLVKNRPEITEYAKRLKARLLALGLGRVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSKDGTTRLKDTVTVRDRDTMEQIRLHVDELEGFLRERLRW 505
3 -108.0002pme_A mol:protein length:693 Glycyl-tRNA synthetase  ali model follow..  34  63DIVDRAKMEDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNIIQTWRQHFIQ-EEQILEIDCTMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRADHFNLMFKTFIGP--GGNMPGYLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPSEKNTVLGYFIGRIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSCHARATKVPLVAEKPLKEPKMINVKRFQKTLYVEEVVPNVIEPSFGLGRIMYTVFEHTFHVR--EGDEQRTFFSFPAVVAPFKCSVLPLSQN-QEFMPFVKELSEALTRHGVSHKVDDSSGSIGRRYARTDEIGVAFGVTIDFDTVNKT-------PHTATLRDRDSMRQIRAEISELPSIVQDLAN. 657
4 -107.0005c51_B mol:protein length:485 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  24  62SGEGSEALLEICQRRHFLSGSKQQLSRDSCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGPLLPGDSAFRLVSAETLREILQDKELSKEQLVAFLEN------VLKTSGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKNGVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEE----GRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHG-----------------RDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENG---------LIHLRSRDTTMKEMMHISKLKDFLIKYIS. 480
5 -107.0002g4c_A mol:protein length:474 DNA polymerase gamma subunit 2  ali model follow..  23  45SGEGSEALLEICQRRHFLSGSKQQLSRDSCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGPLLPGDSAFRLVSAETLREILQDKELSKEQLVTFLE------NVLKTSGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKQGVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGN----KLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHG-----------------RDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENG---------LIHLRSRDTTMKEMMHISKLKDFLIKYIS. 463
6 -105.0004ztu_B mol:protein length:472 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  24  38SGEGSEALLEICQRRHFLSGSKQQLSRDSCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGPLLPGDSAFRLVSAETLREILQDKELSKEQLVAFLEN------VLKTSGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKNGVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGN----KLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHG-----------------RDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENG---------LIHLRSRDTTMKEMMHISKLKDFLIKYIS. 456
7 -99.1001g5h_A mol:protein length:454 MITOCHONDRIAL DNA POLYMERASE ACCESSORY SUBUNIT  ali model follow..  24  20HAVAREALVDLCRRRHFLSGTPQQLSTAALLARFGPLGVELRKNLASQWWSSMVVFREQVFAVDSLHQEPGSSQPRDSAFRLVSPESIREILQDREPSKEQLVAFLE------NLLKTSGKLRATLLHGALEHYVNCLDLVNRKLPFGLAQIGVCFHNSNQTPSSVTRVGEKTEASLVWFTPTRTSSQWLDFWLRHRLLWWRKFAMSPSNFSSA----DCQDELGRKGSKLYYSFPWGKEPIETLWNLGDQELLHTYPGNVSTIQG-----------------RDGRKNVVPCVLSVSGDVDLGTLAYLYDSFQLAENKKSLQRKVLKLHPCLAPIKVALDVGKGPTVELRQVCQGLLNELLENGISVWSETVHSSLEQLHSKYDEMSVLFSVLVTETTLENG---------LIQLRSRDTTMKEMMHISKLRDFLVKYLA. 438
8 -89.8003ikl_A mol:protein length:459 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  25  62SGEGSEALLEICQRRHFLSGSKQQLSRDSLLPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVD--------------------------------------ALHHKPGPLLPGDSAFRGGLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKNGVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEE----GRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKL-----------------HGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENG---------LIHLRSRDTTMKEMMHISKLKDFLIKYIS. 448
9 -75.5005c53_B mol:protein length:903 Pol gamma B  ali model follow..  26  62SGEGSEALLEICQRRHFLSGSKQQLSRSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGPLLPGDSAFR---------------------------------------KLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKNGVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEE----GRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHG-----------------RDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENG---------LIHLRSRDTTMKEMMHISKLKDFLIKYIS. 447
10 -59.3004p3n_A mol:protein length:415 Threonine--tRNA ligase, cytoplasmic  ali model follow..  15  10............RKIGRDQELYFFHELSPGSCFFLPKGAYIYNALIEFIRSEY--RKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMF-----------------------SFEVEKELFALKPMNCPGHCLMFDHRPRSWR-ELPLRLADFGVLHRNELSGATGLTRVRRFQQDDAHIFCAMEQIEDEIKGCLDFLRTVYSVFGF---SFKLNLSTRPEKFLGDIEVWDQAEKQLENSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLP-IRFNLTYVSHDGDDKKRVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVG---PTCDEYAQKVRQQFHDAKFMADIDDPGCTLNKKIRNAQLAQYNFILVVGEKEKISG---------TVNIRTRDNKVHGERTISETIERLQQLKE. 399
11 -58.7004hwt_A mol:protein length:413 Threonine--tRNA ligase, cytoplasmic  ali model follow..  15  1.......MARDHRKIGRDQELYFFHELSPGSCFFLPKGAYIYNALIEFIRSEY--RKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMF-----------------------SFEVEKELFALKPMNCPGHCLMFDHRPRSWR-ELPLRLADFGVLHRNELSGATGLTRVRRFQQDDAHIFCAMEQIEDEIKGCLDFLRTVYSVFGF---SFKLNLSTRPEKFLGDIEVWDQAEKQLENSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLP-IRFNLTYVSHDGDDKKRVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVG---PTCDEYAQKVRQQFHDAKFMADIDDPGCTLNKKIRNAQLAQYNFILVVGEKEKISG---------TVNIRTRDNKVHGERTISETIERLQQLKE. 395
12 -57.8004hwo_A mol:protein length:411 Threonine--tRNA ligase  ali model follow..  14  1.......MARDHRKIGKQLDLYHMQEEAPGMVFWHNDGWTIFRELEVFVRSKL--KEYQYQEVKGPFMMDRVLWEKTGHWDNYKDAMF-----------------------TTSSENREYCIKPMNCPGHVQIFNQGLKSYR-DLPLRMAEFGSCHRNEPSGSHGLMRVRGFTQDDAHIFCTEEQIRDEVNGCIRLVYDMYSTFGFEKIVVKLS--TRPEKRIGSDEMWDRAEADLAVALEENNIPFEYQLGEGAFYGPKIEFTLYDCLDRAWQCGTVQLDFSLP-SRLSASYVGEDNERKVPVMIHRAILGSMERFIGILTEEFAGFFPTWLAPVQVVIMNIT---DSQSEYVNELTQKLSNAGIRVKADLRNEKIGFKIREHTLRRVPYMLVCGDKEVESG---------KVAVRTRRGKDLGSMDVNEVIEKLQQEIR. 394
13 -55.4003ugq_A mol:protein length:460 Threonyl-tRNA synthetase, mitochondrial  ali model follow..  10  19TKNASSATPA--SMVSQRQDLFMTDPLSPGSMFFLPNGAKIFNKLIEFMKLQQ-KFKFGFNEVVTPLIYKKTLWEKSGHWENYADDMFKVET--------------------TDEEKEEYGLKPMNCPGHCLIFGKKDRSYN-ELPLRFSDFSPLHRNEASGASGLTRLRKFHQDDGHIFCTPSQVKSEIFNSLKLIDIVYNKIFPFVKNYFINFSTRPDHFIGDLKVWNHAEQVLKEILEESGKPWKLNPGDGAFYGPKLDIMVTDHLRKTHQVATIQLDFQLP-ERFDLKFKDQDNSYKRPIMIHRATFGSIERFMALLIDSNEGRWPFWLNPYQAVIIPVNTKNVQQLDMCTALQKPLNDWHFNVDLDIRNEPVGYRIKSAILKNYSYLIIVGDEEVQLQ---------KYNIRERDNRKSFKLTMSQIWEKFIELEK. 451
14 -54.9001nyq_A mol:protein length:645 threonyl-tRNA synthetase 1  ali model follow..  13  224DKKELKAHLQMLRKIGKELELFTNSQLVAGLPLWLPNGATIRREIERYIVD--KEVSMGYDHVYTPVLANVDLYKTSGHWDHYQEDMFPPM---------------------QLDETESMVLRPMNCPHHMMIYANKPHSYR-ELPIRIAELGTMHRYEASGASGLQRVRGMTLNDSHIFVRPDQIKEEFKRVVNMIIDVYKDFGFEDYSFRLRDPEDKEKYFDDDDMWNKAENMLKEAADELGLSYEEAIGEAAFYGPKLDVQVKTAMGKEETLSTAQLDFLLP-ERFDLTYIGQDGEHHRPVVIHRGVVSTMERFVAFLTEETKGAFPTWLAPKQVQIIPVNVDLH--YDYARQLQDELKSQGVRVSIDDRNEKMGYKIREAQMQKIPYQIVVGDKEVENN---------QVNVRQYGSQDQETVEKDEFIWNLVDEIR. 640
15 -54.0003a31_A mol:protein length:471 Probable threonyl-tRNA synthetase 1  ali model follow..  13  5QDKTHIDYAYELRVPVFNREFATFTG--AGVPLFSLGGGPIRYALAEVLAKFH--ARRGYYVVETPIIASTELFKVSGHIEFYRNNMY-----------------------LFDIEGHEFAVKPMNCPYHILLFLNEVAKHRLPLPFKVFEFGRVHRYEPSGSYGLLRVRGFTQDDAHIIVPGGRVIDVVYDVFEEMKLVLERLGVSSETFKVRKSLIGKEFMGSKEEWEGAEEALREAASRINEKYGIDIGEAAFYGPKLDFIEESGVSKEWQMGTIQFDFNLPRRFRLYDVVREEFGIEEVYIIHRALLGSIERFLGVYLEHRRGRMPFTLAPIQFAVIAVKTGGREIEDLASSIAKGLLDKGFRVAVKGSSKGLSSDVRHIESTAKPAVVFIGAKEVREK---------VLDVRVFDLESMKRRRLAIAYGDAADAVE. 440
16 -51.1001qf6_A mol:protein length:642 THREONYL-TRNA SYNTHETASE  ali model follow..  14  225DKKALNAYLQRLRKIGKQLDLYHMQEEAPGMVFWHNDGWTIFRELEVFVRSKL--KEYQYQEVKGPFMMDRVLWEKTGHWDNYKDAMF-----------------------TTSSENREYCIKPMNCPGHVQIFNQGLKSYR-DLPLRMAEFGSCHRNEPSGSHGLMRVRGFTQDDAHIFCTEEQIRDEVNGCIRLVYDMYSTFGFEKIVVKLS--TRPEKRIGSDEMWDRAEADLAVALEENNIPFEYQLGEGAFYGPKIEFTLYDCLDRAWQCGTVQLDFSLP-SRLSASYVGEDNERKVPVMIHRAILGSMERFIGILTEEFAGFFPTWLAPVQVVIMNIT---DSQSEYVNELTQKLSNAGIRVKADLRNEKIGFKIREHTLRRVPYMLVCGDKEVESG---------KVAVRTRRGKDLGSMDVNEVIEKLQQEIR. 633
17 -50.7004k86_A mol:protein length:535 Proline--tRNA ligase  ali model follow..  13  34EAKKEENLADWYSQVITKSEMIEYHD-ISGCYILRPWAYAIWEAIKDFFDAEI--KKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRSG-----------------KTELAEPIAIRPTSETVMYPAYAKWVQSHR-DLPIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHSAATMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFIS-----ASGRAIQGGTSHHLGQNFSKMFE-----------------IVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGDNM---------LVLPPRVACVQVVIIPCEEDKEALIAKCNDYRRRLLSVNIRVRADLRDNSPGWKFNHWELKGVPIRLEVGPRDMKSC---------QFVAVRRDTGEKLTVAENEAETKLQAILE. 423
18 -50.6002i4l_A mol:protein length:458 Proline-tRNA ligase  ali model follow..  14  26.KENPKEAEIVSHRL--MLRAGMLRQEAAGIYAWLPLGHRVLKKIEQIVREEQ--NRAGAIELLMPTLQLADLWRESGRYDAYGPEMLRIADR----------------------HKRELLYGPTNEEMITEIFRAYIKSYK-SLPLNLYHIQWKFRDEQRPRFGVMRGREFLMKDAYSFDVDEAARKSYNKMFVAYLRTFARMGLKAIPMRAE--TGPIGGDLSHEFIVLAETGESGVYIDRDVLNLPVPDENVDYDGDLTPIIKEANRLNTRGIEVGQIFYFGTKDSMKANVTGPDGTDAPIHGGSYGVGVSRLLGAIIEACH-IIWPEAVAPFRVTILNLKQGDAATDAACDQLYRELSAKGVDVLYDDTDQRAGAKFATADLIGIPWQIHVGPRGLAEG---------KVELKRRSDGARENLALADVVARLT..... 452
19 -49.7001nj1_A mol:protein length:501 Proline-tRNA Synthetase  ali model follow..  18  28.GEKMTEFSEWFHNILEEAEIIDQRYPVKGMHVWMPHGFMIRKNTLKILRRIL---DRDHEEVLFPLLVPEDLAKEAIHVKGFEDEVYWVTHGGL------------------SKLQRKLALRPTSETVMYPMFALWVRSHT-DLPMRFYQVVNTFRYETKHTPLIRVREITTFKEAHIHATASEAEEQVERAVEIYKEFFNSLGIP---YLITRRPPWDKFPGSEYTVAFDTLMPDGKTLQIGTVHNLGQTFARTFE--------------------IKFETPEGDHE---YVHQTCYGLSDRVIASVIAIH--------GDESGLCLPPDVAAHQVVIVPIIKAAEEVMEACRELRSRLEAAGFRVHLDDRDIRAGRKYYEWEMRGVPLRVEIGPRDLEKG---------AAVISRRDTGEKVTADLQGIEETLRELMK. 407
20 -49.6001nj8_A mol:protein length:459 Proline-tRNA Synthetase  ali model follow..  16  1.GSHMLEFSEWYSDILEKAEIYDVRYPIKGCGVYLPYGFKIRRYTFEIIRNLL--DESGHDEALFPMLIPEDLLAKEAHIKGFEDEVY-------------------VTHGGKTQLDVKLALRPTSETPIYYMMKLWVKVHT-DLPIKIYQIVNTFRYETKHTRPLIRLREITFKEAHTASTKEEAENQVKEAISIYKKFFDTLGIPYLISK-----------------------------------RPEWDKFPGAEYTMAFDTIFPDGRTMQIATVHNLGQNFSKTFEIIFETPTGDKDYAYQTCYISDRVIASIIAIHGDEKGLILPPIVAPIQVVIVPLIKGKEDIVMEKAKEIYEKLKGKFRVHIDDRDIRPGRKFNDWEIKGVPLRIEVGPKDIENK---------KITLFRRDTMEKFQVDETQLMEVVEKTLN. 380
21 -48.9003ial_A mol:protein length:518 Prolyl-tRNA synthetase  ali model follow..  14  11LTKTRDTFADWFDAIMDAAELVDRRYPVKGCVVFRPYGFFMENAIMRLCEEEY--AKVGISQILFPTVIPESFKKESDHIKGFEAECFWVEKGGL------------------QPLEERLALRPTSETAIYSMFSKWVRSYK-DLPLKIHQTCTIFRHETKNTKPLIRVREIHWNEAHCCHATAEAVSQLSDYWKVIDTIFSDELCFKGQKLRRVCWDRFPGADYSEVSDVVMP------CGRVLQTAGIHNLGQRFSSTFDILYANKANESV-------------------HPYLTCAGISTRVLACALSIHGDSG---------LVLPPLIAPIHVVIIPIGCGKKNNQESDQQVLGKKSKLGLRVSIDDDFSSMGDKLYYYELKGVPLRIEVGQRDLANG---------QCIVVPRDVGKDQKIPITEVMKVSSHTTE. 401
22 -48.6004ncx_A mol:protein length:506 Proline--tRNA ligase  ali model follow..  13  9TSKKIENFSDWYTQVIVKSELIEYYD-ISGCYILRPAAYYIWECVQAFFNKEI--KKLNVENSYFPLFVTKNLEKEKNHIEGFSPEVAWVTKYGD------------------SNLPEEIAIRPTSETIMYSVFPKWIRSYR-DLPLKLNQWNTVVRWEFKQPTPFIRTREFLWQEGHTAKNEEEAVKLVFDILDLYRRWYEEYLAVPIIKGIKSEGEKFGGANFTSTAEAFIS-----ENGRAIQAATSHYLGTNFAKMFKIEFEDENEVKQ-------------------YVHQTSWGCTTRSIGIMIMTHGDDK---------LVLPPNVSKYKVVIVPITTDENAIHSYCKDIEKILKNAQINCVYDDRASSPGYKFNHWELRGIPIRIEVGPKDLQNN---------SCVIVRRDNNEKCNVKKESVLLETQQMLV. 392
23 -47.9004hvc_A mol:protein length:519 Bifunctional glutamate/proline--tRNA ligase  ali model follow..  14  18EAKKEENLADWYSQVITKSEMIEYHD-ISGCYILRPWAYAIWEAIKDFFDAEI--KKLGVENCYFPMFVSQSALEKEKHVADFAPEVAWVTRSGK------------------TELAEPIAIRPTSETVMYPAYAKWVQSHR-DLPIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHSAATMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFIS-----ASGRAIQGGTSHHLGQNFSKMFE-----------------IVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGDNM---------LVLPPRVACVQVVIIPCEEDKEALIAKCNDYRRRLLSVNIRVRADLRDNSPGWKFNHWELKGVPIRLEVGPRDMKSC---------QFVAVRRDTGEKLTVAENEAETKLQAILE. 407
24 -47.6005xif_A mol:protein length:500 Prolyl-tRNA synthetase (ProRS)  ali model follow..  16  9DENFSEWYTQAIVRSEMIE-----YYDISGCYIMRPWAFHIWEKVQRFFDDEI--KKMGVENSYFPMFVSRHLEKEKDHVEGFSPEVAWVTHYGD------------------SPLPEKIAIRPTSETIMYPAYAKWIRSHR-DLPLKLNQWCSVVRWEFKQPTPFLRTREFLWQEGHTAATEEEAWELVLDILELYRRWYEECLAVPVIKGEKSEGEKFAGGKKTTTVEAFIP-----ENGRGIQAATSHLLGTNFAKMFEIEFEDEEGHKR-------------------LVHQTSWGCTTRSLGVMIMTHGDDK---------LVIPPRVASVQVVIIPIDENTGEILGKCRELKTMLEKADIRVRIDDRSNTPGWKYNHWEVKGVPLRLELGPKDLAKG---------TARVVRRDTGEAYQISWADLAPKLLELME. 388
25 -47.6005xip_A mol:protein length:498 Prolyl-tRNA synthetase, putative  ali model follow..  14  6TAKKSTNFADWYTQVIVRGELVEYYD-ISGCYIIRPWAYRIWEAVQKFFDDGI--KRLGVENCYFPMFVSQALEKEKDHVEGFKPEVAWVTHYGD------------------SELPEKVAIRPTSETIMYPAYAKWIRSHR-DLPLKLNQWNNVVRWEFKQPTPFLRTREFLWQEGHTAATEEEAYTLVLEILELYRQWYEDYLAVPVIK-----GEKSENEKFAGGKKTTTIEGIIPDTGRGIQAATSHLLGQNFSRMFSIEFEDEKGAKQ-------------------LVHQTSWGCTTRSLGVMIMTHGDDK---------LVLPPRVVAVQAVIIPIIFKETGIVAKCRELERLLNAAGVRVKVDDRTNTPGWKFNDWELKGVPLRLEIGPRDVESC---------QTRVVRRDTSEARNVPWAEAASTIPAMLE. 389
26 -47.2005f9y_A mol:protein length:511 Aminoacyl-tRNA synthetase  ali model follow..  14  13TADKITSFADWYSQVIVKSEMIEYYD-ISGCYILRPWSYFIWETIQSVFDQKI--KQHDVQNAYFPIFVTQKLETEKDHVEGFSPEVAWVTKSGK------------------SDLAEPIAIRPTSETIMYPYFAKWIRSHR-DLPLKINQWTSIVRWEFKHPTPFIRTREFLWQEGHTAHSTRKEA-------------------------------LEMVDIILNEYASIYEDLLATPVVKGTKSENEKFPGGDITKSIEGFIPEI-GRAVQAATSHLLGQNFSKMFGVEFEDEKG---NKEYAHQTSWGLTTRAIGVMIMTHGLVLPPKVAPVQVIIIPITVITEEQKKICNEVECILKKAGVRVKIDDRSNTPGWKYNHWEVKGVCLRFEVGPRDIEKR---------SVRVVVRDNMEKMDIPISELESKIPKLLE. 396
27 -45.1001h4q_A mol:protein length:477 PROLYL-TRNA SYNTHETASE  ali model follow..  17  11SQDFSEWYLEVIQKAELA------YGPVRGTIVVRPYGYAIWENIQQVLDRMF--KETGHQNAYFPLFIPMSLRKEAEHVEGFSPELAVVTHAGG------------------EELEEPLAVRPTSETVIGYMWSKWIRSWR-DLPQLLNQWGNVVRWEMRT-RPFLRTSEFLWQEGHTAATREEAEEEVRRMLSIYARLAREYAAIPVIEGLKTEKEKFAGAVYTTTIEALMK------DGKALQAGTSHYLGENFARAFDIKFQDRDLQVK-------------------YVHTTSWGLSWRFIGAIIMTHGDDR---------LVLPPRLAPIQVVIVPIYESRERVLEAAQGLRQALLAQGLRVHLDDRDQTPGYKFHEWELKGVPFRVELGPKDLEGG---------QAVLASRLGGKE-TLPLAALPEALPGKLD. 386
28 -44.9005xil_A mol:protein length:512 Putative prolyl-tRNA synthetase  ali model follow..  13  6AAKREENFSAWYIDVITKAEMIE-YYDVSGCYIIRPWAYYVWKCVQRFLGGKI--EKLGVEDCYFPMFVSRSLEREKDHIEGFAPEVAWVTRAGD------------------TELEQPVAVRPTSETVMYPYYAKWIRSHR-DLPVRLNMWNNVIRWEFSHPTPFIRTREFLWQEGHCAAKAEECAKEVLEILECYASVYEQLLAVPVVRGRKTEKEKFAGGDYTTTVETFIEAVGRGCQGATS-----HNLGQNFGKMFD-----------------IRFQDPENNEQTLIPWQNSWGLSTRVIGVMIMVHGDNR---------MVMPPRVASTQVIIIPVEEARQELLASCWRLESELCEGGVRARCDLRDNSPGWRFNHWEVKGVPLRVELGPRELAER---------SLAVAVRHSGARHSVAWDAQTPAAVAAL.. 394
29 -39.7002j3l_A mol:protein length:572 PROLYL-TRNA SYNTHETASE  ali model follow..  14  24.........QILLRAGY------IRQVAAGIYSYLPLANRVLEKLKTIMREEF--EKIDAVEMLMPALLPAELWKESGRYETYGPNLYRLKDRN----------------------DRDYILGPTHEETFTELIRDEINSYK-RLPLNLYQIQTKYRDEKRSRSGLLRGREFIMKDGYSFADEASLDQSYRDYEKAYSRIFERCGLE-----FRAIIGDGGAMGGKDSKEFMAISEIGEDTITESDYAANLEMATSLYTPKKSHETQLDLEKIATPEVGTIAEAFTKGIEIGHIFKLGTRYSDAMGATVLDENGREKVEQNADERGINWPTGIAPFDLHVVQMNVKDEYQTKLSQEVEAMMTEAGYEVLVDDRNERAGVKFADADLIGCPIRITVGKKAVD----------GVVEVKIKRTGEMLEVRKEELESTLSILMN. 566
30 -34.8005ucm_A mol:protein length:579 Proline--tRNA ligase  ali model follow..  13  26.........QLLLRAGMIRRL------ASGLYTWLPMGLRVLRKVETIVREEM--NAAGALEVLMPAVQPAELWQESGRWEQYGPELLRLKDR----------------------HEREFCVGPTHEEVITDLARNELNSYK-QLPINFYQIQTKFRDEIRPRFGLMRGREFIMKDAYSFLSQDSLQQTYDGMYQAYSKIFSRLGLD-----FRPVQADNGSIGGSGSHEFHVLANSGEDDIDSSDYAANIEKAEAVPRESARGSATEDMRLVDTPNTKTIAAVIKRGIEVGHIFQLGTKYSEAMKLSVLSEQGKPVIEQNHDERGILWPSALAPFQIALVPLKYETESVKQATDKLYAELTAAGFEVLLDDRDKSPGVKFADMELIGIPHRIVISDRGLSEG---------VLEYKGRRDSESQNLPIGELMSFITEKLS. 572
31 -27.6003qne_A mol:protein length:485 Seryl-tRNA synthetase, cytoplasmic  ali model follow..  14  155........HEVLLRLDGYDPERGVRIVGHRGYFLRNYGVFLNQALINYGLSFLS--SKGYVPLQAPVMMNKEVMAKTAQLSQFDEELYK----------------------VIDGEDEKYLIATSEQPISAYHAGEWFESPAEQLPVRYAGYSSCFRREAGSHWGIFRVHAFEKIEQFVLTEPEKSWEEFDRMIGCSEEFYQSLGLP---YRVVGIVSGELNNAAAKKYDLEAWFP-EYKELVSCSNCTDY-------------------QSRNLEIRCGIKQQNQQEKKYVHCLNSTLATERTICCIL-------------ENYQKEDGLVIPEV---LRKYIPGEPEFIPYIKELPKNTTSVKKAKGKNPKNTTSVKKAKGKN......................................................... 476
32 -25.9002cim_A mol:protein length:522 SERYL-TRNA SYNTHETASE  ali model follow..  10  197.....EDPTQAMMKEGWLKRG-----SSRGQWIHGPQSARIFRTFEKIVLEELL-EPLGYREMIFPKLVTWEVWMKSGHAKGVYPEIYDPDYWEEVADYYKVTHEVPTKLIKEKIAEPIGGMCYAQCPPFWMYVAGETLPNE-EIPVKVFDRGTSHRYESGGIHGIERVDEFHRIEIVWIGTKEEVLKCAEELHDRYMHIFNDILDIEWRKARVTGLLGLAEENTVGTTDYEACLPYRGPDGEWLEFQNVSINGDKYPKG---------------------FNVKLQSGDELWSGCSGVGLERWAAVFL-------------AQKGLDPANWPEEFRNRVGEMPK................................................................................................. 511
33 -24.0001qe0_A mol:protein length:420 Histidine--tRNA ligase  ali model follow..  10  1.......................MIKIPRGTQDILPEDSKKWRYIENQLDE--LMTFYNYKEIRTPIFESTDLFARG---------------------GDSTDVVQKEMYTFKDKGDRSITLRPEGTAAVVRSYIEHKMQGNPNQPIKLYYNGPMFRYERKQKG---RYRQFNQFGVEAIGAENPSVD--AEVLAMVMHIYQSFGLKHLKLVINSVGDMAEPVIHEFCSDCQSRLHTDPMRILDCKVDRDKEAIKTAPRITDFLNEESKAYYEQVKAYLDDLGIPYTTHTAFELMMDNPNYDGAITTLCGGGRYNGLLELLDGPSETGIGFALSIERLLLA-IVTMGDQADRYAVKLLNHLRHNGIKADKDYLQRKIKGQMKQADRLGAKFTIVIGDQELENN---------KIDVKNMTTGESETIELDALVEYFKK.... 420
34 -22.2003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  12  16............................SGFPEFLPSEKRLELYLLDTIRR--VYESYGFTPIETPAVERLEVL--QAKGNQGDNIIYGLEPILPPNRQAEKDKS-------GDTGSEARALKFDQTVPLAAYIAR--HLNDLTFPFARYQMDVVFRGERAKDG---RFRQFRQCDIDVVGREKLSLLYDAQMPAIITEIFEAVNIGDFVIRINNRKSETQIKSCISIIDNLEKIGEAKVKLEGINPEQTQKIIDFVKIDGSVDDVLDKLKHLSQTLPESEQFNLGVSYYTGTVYETTLIGHEALGSICSGGRYEELVGTFIGEKMPGVGISIGLTRLISR-VVNMQDELMPTYLKVSQQLRQAGLNVITNFEKRQLGKQFQAADKQGIRFCVIIGADEAAAQ---------KSSLKDLQSGEQVEVALADLAEEIKRRLT. 465
35 -22.1003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  14  2...AMGTLEAQTQGPGSMQKNMVETEPVQGCRDFPPEAMRCRRHLFDVFHA--TAKTFGFEEYDAPVLESEELYIRK---EEITEQMFN-----------------------ITKGGHRVALRPEMTPSLARLLLG--KGRSLLLPAKWYSIPQCWRYEAITR----RRREHYQWNMDIVGVKSVSAE--VELVCAACWAMRSLGLSSKDVGIKVNSRAPVCVIVDKMEKIPREEVEAQLAVLGLEPTVVDAITTTLSLKSIDEIAQRVGEEHEAVKELRQFFEQVEAYGYGDWVLFDASVVRGLAYYTGIVFEGFDREGKFRALCGLLPDIPHVVDDVVIPF---DESMRPHALAVLRRLRDAGRSADIILDKKKVVQAFNYADRVGAVRAVLVAPEEWERG---------EVQVKMLREGTGKEEGGAERGFAVPLD... 447
36 -21.5001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  10  10............................RGFRDFYPEDMDVEKFIFKTAEE--AAEAFGFRRIDFPSLEYLDLYRIK-------------------------EELLQQTYSFVDKGGREVTLIPEATPSTV---RMVTSRKDLQRPLRWYSFPKVWRYEEPQA----RYREHYQFNADIFGSDSPEAD--AEVIALASSILDRLGLQDIEIRINSRKTSSDPFSVFSIIDRYHKISREEFVDQLRSAGIGEDGVSMIADLCSGTRGIDEMARITGKSSEEIARMAAVEDLLASYGVKNVRYDFSIVAILGGGRYDNLASLMSGESVPAVGFGMGDAVISLL-ICRVGKINSSIMNEYSRKLRERGMNVTVEIMERGLSAQLKYASAIGADFAVIFGERDLERG---------VVTIRNMYTGSQENVGLDSVVEHLISQAT. 426
37 -21.5003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  15  2...AMGTLEAQTQGPGSMQMNMVETEPVQGCRDFPPETMRLRKYLFDVFHS--TARKFGFEEYDSPVLESEELYIRK---EEITEQMFN-----------------------ITKGGHRVALRPEMTPSLARQLLA--KGRSLLLPAKWYSIPQCWRYEAITR----RRREHYQWNMDIIGVKSVSSE--VELVCAACTAMQSLGLSSKDVGVKINSSADKFAPVCVIVDKMEKLPREEVVAQGLESNVVDAITSTLSLKTIDEIAQRIGEEHEAVRELRDFITQIEAYGFGDWVIFDASVVRGLAYYTGIVFEGFDRDGNFRALCGLLPELHHVVDDLVIPF---DETMRPHALSILRRLRDAGRSADIVFDKKKVVQAFNYADRIGALRAVLVAPDEWARG---------EVRVKMLREGAGREEGANERGIVLPVD... 447
38 -21.2004h2w_A mol:protein length:346 Amino acid--[acyl-carrier-protein] ligase 1  ali model follow..  13  21.PNSPDTAPQIADPLDHLADKLFHSMGSDGVYARTALYESIVERLAALITS---HREAGTEALRFPPVMSRAQLEKSGYLKSFPNLLVCGLHGTEREINAAVSRFDAGGDWTTSLSPADLVLSPAACYPVYPIAAS--RGPLPKGGLRFDVAADCFRRE--PSKHLDRLQSFRMREYVCIGTPDDVSDFRERWMVRAQAIARDLGLTDPFFGRAGKMLANNQRDQQLKFELLIPLR-QPTACMSFNYHREHFGTTW--------------------------GIQDANGEPAHTGCVAFGMDRLAVAMFHTHGTDLSAWPAKVRDILGLQPHVAAGAHG....................................................................................................... 336
39 -20.8003mey_A mol:protein length:346 Bll0957 protein  ali model follow..  15  21.PNSPDTAPQIADPLDHLADKLFHSMGSDGVYARTALYESIVERLAALITS---HREAGTEALRFPPVMSRAQLEKSGYLKSFPNLLVCGLHGTEREINAAVSRFDAGGDWTTSLSPADLVLSPAACYPVYPIAAS--RGPLPKGGLRFDVAADCFRRE--PSKHLDRLQSFRMREYVCIGTPDDVSDFRERWMVRAQAIARDLGLT---------------FRVDYASDPFFGRVGQMKAVSQKQQQLKFELLIPLRSEEQPTACMSFNYHREHFGTTWGIQDANGEPA--HTGCVAFGMDRLAVAMFHTHGTDLSAWPAKVRDILGLQPHVAA........................................................................................................... 332
40 -20.4004rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  15  9............................RGTKDLFGKELRMHQRIVATARK--VLEAAGALELVTPIFEETQVFEKG---------------------GAATDIVRKEMFTFQDRGGRSLTLRPEGTAAMVRAYLE--GMKVWPQPVRLWMAGPMFRAERPQKG---RYRQFHQVNYEALGSENPILD--AEAVVLLYECLKELGLRRLKVKLSEDSKERLELNPMRILDSKSERDQALLKELGVRPMLDFEVERHLERLSVPYELEPALVRGLDYYVRTAFEVHHEEIGAQSALGGGGRYDGLSELLGGPRVPGVGFAFGVERVALALEAE-KGPDLYLIPL---TEEAVAEAFYLAEALRP-RLRAEYALAPRKPAKGLEEALKRGAAFAGFLGEDELRAG---------EVTLKRLATGEQVRLSREEVPGYLLQALG. 423
41 -20.3004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  12  43.EEEVAKLLKLKAQLGPDESKQKFVKTPKGTRDYSPRQMAVREKVFDVIIR--CFKRHGAEVIDTPVFELKETLMGK------------------------YGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAM-----NKLTNIKRYHIAKVYRRD-NPAMTRGRYREFYQCDFDIAGNFDPMIPDAE-CLKIMCEILSSLQIGDFLVKVNDRRSDSKFRTICSSVDKLDKVSWEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDDKISFDLSLDGLVGMFDPKGRKVPCVGLSIGVERIFSIVVLVASAQKKLLEERLKLVSELWDAGIKAELLKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDG---------VIKLRSVTSREEVDVRREDLVEEIKRRTG. 514
42 -20.2005e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  14  10............................KGFNDVLPTQTAAWRRLEQHLAS--LMDAYGYQQIRLPIVEQTGLFKRA--------------------DATDIVEKEMYTFFDKGNPPESLTLRPEGTAGCVRALVE--HNLLRGATPRVWYMGPMFRYE-KPQKG--RYRQFHQFGVETFGVATPDID--AELIMLTARLWKRMGVDHMQLELNTLGETDNEHKDALDEDSQRRLTTNPLRILDSKIESTQKILENAPKLHDFLKEDSLSHFQQLQDYLTAAGIK---VINQKLVRGLDYYNKTVFEWTTTALGSQGTAMGMERLLLLLEQVQAEIVRDCEAFLVAEPAYQSKALVLAEQLRDQLEAANSNGSQGSMKSQMKKADQAGAVYAIILGEREWEAQ---------QLAVKELATAEQSQVALAELVPFLIEKFT. 431
43 -20.1003w3s_A mol:protein length:527 Type-2 serine--tRNA ligase  ali model follow..  13  210..........................PGRGQWIYTPPMAALFEVLRDFLLER-VTRKLGFEPALFPKLIPLETMFRMRYLHGLPDGMYYVCPPKRDPELFDDFKRELYVWGELNERDPGYVLAPAQCEPFYELLRDEV-VDPERLPIKLYDCGWTYRWEGGAAKGLERVNEFQRIEHVWIAEPEEAYRIRRELLEATKRVAEELELEWKVVVSDDLEDRDIELPDVPSYEFEVYLPFKGERSSEEAWISVGSFNVHGEHFVDG------------------FNVKEKSGRTLFTGCAGLGVTRWVVGLL------AQHGFYPYEWPEPILERIDEKFGGLPEVPKTLT.............................................................................................. 524
44 -20.0001v95_A mol:protein length:130 Nuclear receptor coactivator 5  ali model follow..  17  8..............................................................................................................................................................................................................................................................................................................................................PVDCSVIVVNKQT---KDYAESVGRKVRDLGMVVDLINTEVSLSQALEDVSRGGSPFAIVITQQHQIHRSC-------TVNIMFGTPQEHRNMPQADAMVLVARNYE. 106
45 -19.8004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  12  18............................KGTRDYSPRQMAVREKVFDVIIR--CFKRHGAEVIDTPVFELKETLMGK------------------------YGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAM-----NKLTNIKRYHIAKVYRRD-NPAMTRGRYREFYQCDFDIAGNFDPMIPDAE-CLKIMCEILSSLQIGDFLVKVNDRRSDSKFRTICSSVDKLDKVSWEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDDKISFDLSLDGLVGMFDPKGRKVPCVGLSIGVERIFSIVVLVASAQKKLLEERLKLVSELWDAGIKAELLKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDG---------VIKLRSVTSREEVDVRREDLVEEIKRRTG. 461
46 -19.3002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  15  16............................RGMNDYLPGETAIWQRIEGTLKN--VLGSYGYSEIRLPIVEQTPLFKRA---------------------GEVTDVVEKEMYTFEDRNGDSLTLRPEGTAGCVRAGIE--HGLLYNQEQRLWYIGPMFRHE-RPQKG--RYRQFHQLGCEVFGLQGPDID--AELIMLTARWWRALGISEHTLELNSIGSLEEQHKEKLDEDCKRRMYTNPLRVLDSKNPEVQALLNDAPALGDYLDEESREHFAGLCKLLESAGIAYTDYYNRTVFEWVTNSLGSQGTVCAGGRYDGLVEQLGGRATPAVGFAMGLERLVLL-LVASGADTQSAAMALAERLRDEGVKLMTNHGGGNFKKQFARADKWGARVAVVLGESEVANG---------TAVVKDLRSGEQTAVAQDSVAAHLRTLLG. 431
47 -18.4004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  14  2AMGTLEAQTQGPGSMTEQKRKLEKLTGVKGMNDILPQDAGLWEFFEATVKS--LLRAYGYQNIRTPIVEHTPLFTRGEVTDIVEKEMYSFVD---------------------ALNGENLTLRPENTAAVVRAA--IEHNMLYDGPKRLWYIGPMFRHE-RPQRG--RYRQFHQVGVEALGFAGPDAD--AEIVMMCQRLWEDLGLTGIKLEINSLGLAEEQHADKLDDDAQRRLYTNPLRVLDTKNPALQEIVRNAPKLIDFLGDVSRAHFEGLQRLLKANNVPFTDYYNLTVFEWVTDKLGAQGTVAAGGRYDPLIEQLGGKPTAACGWAMGIERILEL-VVHQGDAAREQAFIVAERLRDTGLDVILDGAGASFKSQMKRADASGAAFAVIFGEDEVTNG---------TASVKPGEKSVQQSVPVESLTEFLINAMV. 453
48 -18.3002lw7_A mol:protein length:170 Histidine--tRNA ligase, cytoplasmic  ali model follow..  14  68.............................................................................................................................................................................................................................................................................................................................................TETQVLVASA---QKKLLEERLKLVSELQDAGIKAELLKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDG---------VIKLRSVTSREEVDVRREDLVEEIKRRTG. 164
49 -16.4002dq3_A mol:protein length:425 Seryl-tRNA synthetase  ali model follow..  16  142........WEIGERLGILDFKRGAKLSGSRFTVIAGWGARLERALINFMLDLHT--KKGYKEICPPHLVKPEILIGTGQLPKFEEDLYK-------------------------CERDNLYLIP-TAEVPLTNLYREEILKEENLPIYLTAYTPCYRREAGAIRGIIRQHQFDKVELVKIVHPDTSYDELEKLVKDAEEVLQLLGLP---YRVVELCTGDLGFSAAKTYDIEVWFP-KYREISSCSNCEDF--------------------QARRMNTRFKDSKTGKNRFVHTLNGSGLAVGRTLAAILENYQQED---------SVVVPEVLRDY.......................................................................................................... 416
50 -15.9002dq0_A mol:protein length:455 Seryl-tRNA synthetase  ali model follow..  17  163........VDLLEILGGADFARAAKVSGSRFYYLLNEIVILDLALIRFALDRLI--EKGFTPVIPPYMVRRFVEEGSTSFEDFEDVIYK-------------------------VEDEDLYLIP-TAEHPLAGMHANEILDGKDLPLLYVGVSPCFRKEAGTTKGIFRVHQFHKVEQFVYSRPEESWEWHEKIIRNAEELFQELEIP---YRVVNICTGDLGYVAAKKYDIEAWMP-KFREVVSASNCTDW--------------------QARRLNIRFRDRTDEKPRYVHTLNSTAIATSRAIVAILENHQEED---------TVRIPKVLWKY.......................................................................................................... 437
51 -15.2003vbb_A mol:protein length:522 Seryl-tRNA synthetase, cytoplasmic  ali model follow..  15  171........VDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLG--SRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKVIGKGSEKSDD--------------NSYDEKYLIA-TSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQEVGSHRGIFRVHQFEKIEQFVYSSPNKSWEMFEEMITTAEEFYQSLGIP---YHIVNIVSGSLNHAASKKLDLEAWFP-AFRELVSCSNCTDYQ------------------ARRLRIRYGQTKKMMDKVEFVHMLNATMCATTRTICAILENYQTEK----------ITVPEKLKEFLQELIPFVKPAPIEQEPSKK--QKKQHEGSKKKAAARDVTLENRLQNME......................................................... 510
52 -15.1001ser_A mol:protein length:421 PROTEIN (SERYL-TRNA SYNTHETASE (E.C.6.1.1.11))  ali model follow..  14  136........HVALMEKNGWWEPRISQVSGSRSYALKGDLALYELALLRFAMDFMA--RRGFLPMTLPSYAREKAFLGTGHFPAYRDQVWA-------------------------IAETDLYLTG-TAEVVLNALHSGEILPYEALPLRYAGYAPAFRSEAGSVRGLMRVHQFHKVEQYVLTEAEASDRAFQELLENAEEILRLLELP---YRLVEVATGDMGPGKWRQVDIEVYLP-RYRETHSCSALLDWQARR---------------------ANLRYRDPEGRVRYAYTLNNTALATPRILAMLLENHQLQD---------RVRVPQALIPY.......................................................................................................... 411
53 -14.8001wle_A mol:protein length:501 Seryl-tRNA synthetase  ali model follow..  16  183........LEIAEKLDIIRQKRLSHVSGHRSYYLRGAGALLQHGLVNFTLNKLI--HRGFTPMTVPDLLRGVVFEGCGMTPNAKPSQIYNID---------------------PSRFEDLNLAG-TAEVGLAGYFMDHSVAFRDLPIRMVCSSTCYRAETDEPWGLYRVHHFTKVEMFGVTGPEQSSELLEEFLSLQMEILTELGLH---FRVLDMPTQELGLPAYRKFDIEAWMP-RFGEVTSASNCTDFQSRR---------------------LHIMFQTEAGELQFAHTVNATGCAVPRLLIALLESYQQKD---------SVLVPPALQPY.......................................................................................................... 461
54 -14.6003err_A mol:protein length:536 fusion protein of microtubule binding domain from mouse cytoplasmic dynein and seryl-tRNA synthetase from Thermus thermophilus  ali model follow..  16  246........VALMEKNGWWEPRISQVSGSRSYALKGD-LALYELALLRFAMDFMA--RRGFLPMTLPSYAREKAFLGTGHFPAYRDQVWAI-------------------------AETDLYLTG-TAEVVLNALHSGEILPYEALPLRYAGYAPAFRSEAGSVRGLMRVHQFHKVEQYVLTEASLEASDFQELLENAEEILRLLELP---YRLVEVATGDMGPGKWRQVDIEVYLP-RYRETHSCSALLDWQARR---------------------ANLRYRDPEGRVRYAYTLNNTALATPRILAMLLENHQLQD---------RVRVPQALIPY.......................................................................................................... 520
55 -14.3003lsq_A mol:protein length:484 Seryl-tRNA synthetase  ali model follow..  16  178........SIMERLGMMDTSKAVTSMAGGRSYVLKGGLVQLQVALVSYSLDFLV--KRGYTPFYPPFFLNRDVMGEVAQLSQFDEELYQ-----------------------VSGDGDKKYLIA-TSEMPIAAYHRGRWFTELKEPLKYAGMSTCFRKEAGAHLGIFRVHQFDKIEQFVVCRQEESWRHLEDMITTSEEFNKSLGLP---YRVVNICSGALNNAAAKKYDLEAWFP-AFRELVSCSNCTDYQSQS----------------NCRYGPNLRGTAAQNVKEYCHMLNGTLCAITRTMCCICENYQTEE----------VVIPDVLRPY.......................................................................................................... 460
56 -14.2006blj_A mol:protein length:485 Serine-tRNA ligase  ali model follow..  14  186........IDIMRKLGGLATEEGTQVGGGRGYFLLGDLVRMNLALQNYAIDFLA--KKGYMPIYTPFFMTKEQMKKVAQLSQFDEELYT-----------------------VTGEGEDKYLIA-TSEQPIAAFHLEKRFDESELPIKYCGMSTCFRKEVGATLGIFRVHQFEKIEQFVVTSPKDNKSWFDEMIGNSEAFYQSLGIP---YRVVNIVSGALNNAAAKKFDLEAWFP-EYRELVSCSNCTDYQ------------------TRRLEVKYGKSKKQGSEVEFCHMLNSTLTATSRTLCCIVENYQTPE----------VNVPEVLQPY.......................................................................................................... 468
57 -14.1003od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  11  14............................FGMRDTLPEWYKTKKNICDQMTE--EINLWGYDMIETPTLEYYETVGVVS------------------------AILDQQLFKLLDQQGNTLVLRPDMTAPIARLVAS--SLKDRAYPLRLAYQSNVYRAQQNEGG---KPAEFEQLGVELIGDGTASAD--GEVIALMIAALKRAGLSEFKVAI-----GHVGYVNALLMDVVGNEQRADRLRRFLYEKNYVGYREHVKSLNLSTIDKSRLMNLLSLRGGRAAIEEARGLIQTEKGKTALAEMTKLYEVLESYGASEYVKFDLDELLSKFHRPAQATGFGVQTCILFSNERRFEAIELARKKRANGEAVVLQDLAGVTDVDAMSSNYQDVIYCIGTAGRGGEDA....................................... 400
58 -13.5004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  13  15LLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEEREYLGKLEREITR--FFVDRGFLEIKSPILIPLEYIERMG------------------------IDNDTELSKQIFRVDKNFCLRPMLAPNLANYLRKLDRALPD--PIKIFEIGPCYRKESDGKE---HLEEFTMLNFCQMGSGCTREN----LESIITDFLNHLGID........................................................................................................................................................................................................................................... 187
59 -13.3005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  11  15LLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEEREYLGKLEREITR--FFVDRGFLEIKSPILIPLEYIERMG------------------------IDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPD--PIKIFEIGPCYRKESDGKE---HLEEFTMLAFAQMGSGCTREN----LESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLEL................................................................................................................................................................................................................... 211
60 -12.8002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  12  79.................................RTVKHRPALLELEEKLAK--ALHQQGFVQVVTPTIITKSALAKMT------------------------IGEDHPLFSQVFWLDGKKCLRPMLAPNLYTLWRELERLWDK--PIRIFEIGTCYRKESQGAQ---HLNEFTMLNLTEL---TPLEERHQRLEDMARWVLEAAGIREFELVTESSV................................................................................................................................................................................................................................. 229
61 -12.8004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  13  32LLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEEREYLGKLEREITR--FFVDRGFLEIKSPILIPLEYIERMG------------------------IDNDTELSKQIFRVDKNFCLRPMLAPNLGNYLRKLDRALPD--PIKIFEIGPCYRKESDGKE---HLEEFTMLNFCQMGSGCTREN----LESIITDFLNHLGID........................................................................................................................................................................................................................................... 204
62 -12.6004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  13  14LLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEEGKLEREITR------FFVDRGFLEIKSPILIPLEYIERMG------------------------IDNDTELSKQIFRVDKNFCLRPMVAPNIFNYARKLDRALPD--PIKIFEIGPCYRKESDGKE---HLEEFTMLNFFQMGSGCTREN----LESIITDFLNHLGID........................................................................................................................................................................................................................................... 186
63 -12.6003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  12  29LLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEEREYLGKLEREITR--FFVDRGFLEIKSPILIPLEYIERMG------------------------IDNDTELSKQIFRVDKNFCLRPMLTPNLYNYLRKLDRALPD--PIKIFEIGPCYRKESDGKE---HLEEFTMLVFWQMGSGCTREN----LESIITDFLNHLGID........................................................................................................................................................................................................................................... 201
64 -11.2002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  13  66.................................YAEERENYLGKLEREITRFF--VDRGFLEIKSPILIPLEYIERMG------------------------IDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPD--PIKIFEIGPCYRKESDGKE---HLEEFTMLNFCQMGSGCTREN----LESIITDFLNHLGIDFKIVG...................................................................................................................................................................................................................................... 209
65 -11.0004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  11  30.EVLLNPKDEISLNSGKPFRELELSRRKKDLQQIYAEEGKLEREITRFF------VDRGFLEIKSPILIPLEYIERMG------------------------IDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPD--PIKIFEIGPCYRKESDGKE---HLEEFTMLSFIQMGSGCTREN----LESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLEL................................................................................................................................................................................................................... 228
66 -10.4003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  13  27............................PGMQDGYPDFAKRRRAVETRLLS--FVEDAGYEPVTSGLFEYVDTLLRA-------------------------PESSRDWIRLFDGGGDAVALRPEMTPSIARMAAP--RVAAGRTPIRWCYCERVYRRTDDPASL--KAAESTQVGIERIGEEASVDVDMD-VLRLLHEASAAAGVRHHRIVVSH-----------------ARLVPRLLDALGISASLSRAFLACLTSG--------------------------NYVQFRELWQLHAAKDVDLLANLLTWSPAERDAAKRSREASDRELEALLRDAVDPRAAADVRDAWRYLCRLAEALHDSGLASDVVTFDLALHRELDYYT--GLVFEMFA--PGVGAPIAQGGRYDELLAQFGAGAPA--AFEVERVMAVLEAQ... 366
67 -9.4206FTT Entity 1(prereleased)  ali follow..  5............................DGVADVLFEDAHKQEVLRHQLTQ--QLITHGYQLVSPPMIEFTESL-LSGASEDLKRQTFKIID---------------------QLTGRLMGIRADIT----PQILRIDAHHGGDGIARYCYAGDVIHTLPSGLF---GSRTPLQLGAEIFGCESIAAD--IELIDVLFSMINSLDMSAVHVDLGH-----------------VTIFKRLAELAALSASDTEQLMQLYANKNLPELKQVCQVLPMGSDFYTLARFGHDIANLLGRLSENAQQDTKIVTAIDELQRLKAHLQVQWQCAVSIDVTEINSETQPLVRGGRFDGMKSNQLATNQPRQATGFSMDVSRLLAHTQLDAPFIVLIDYDAFNNLDSAQRQLLLQQVAS------LRQQGYRVTMPLTAEDMPVGLTHRLSL 378
68 -9.4205m8h_A mol:protein length:388 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  5............................DGVADVLFEDAHKQEVLRHQLTQ--QLITHGYQLVSPPMIEFTESL-LSGASEDLKRQTFKIID---------------------QLTGRLMGIRADIT----PQILRIDAHHGGDGIARYCYAGDVIHTLPSGLF---GSRTPLQLGAEIFGCESIAAD--IELIDVLFSMINSLDMSAVHVDLGH-----------------VTIFKRLAELAALSASDTEQLMQLYANKNLPELKQVCQVLPMGSDFYTLARFGHDIANLLGRLSENAQQDTKIVTAIDELQRLKAHLQVQWQCAVSIDVTEINSETQPLVRGGRFDGMKSNQLATNQPRQATGFSMDVSRLLAHTQLDAPFIVLIDYDAFNNLDSAQRQLLLQQVAS------LRQQGYRVTMPLTAEDMPVGLTHRLSL 378

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 6 3 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Flexible structure alignment by chaining aligned fragment pairs allowing twists. Bioinformatics. 2003 Oct;19 Suppl 2:II246-II255.