current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 1efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580
# Score Template Links and tools%idFirst MRRTHYAGSLRETHVGEEVVLEGWVNRRRDLGGLIFLDLRDREGLVQLVAHPASPAYATAERVRPEWVVRAKGLVRLRPEPNPRLATGRVEVELSALEVLAEAKTPPFPVDAGWRGEEEKEASEELRLKYRYLDLRRRRMQENLRLRHRVIKAIWDFLDREGFVQVETPFLTKSTPEGARDFLVPYRHEPGLFYALPQSPQLFKQMLMVAGLDRYFQIARCFRDEDLRADRQPDFTQLDLEMSFVEVEDVLELNERLMAHVFREALGVELPLPFPRLSYEEAMERYGSDKPDLRFGLELKEVGPLFRQSGFRVFQEAESVKALALPKALSRKEVAELEEVAKRHKAQGLAWARVEEGGFSGGVAKFLEPVREALLQATEARPGDTLLFVAGPRKVAATALGAVRLRAADLLGLKREGFRFLWVVDFPLLEWDEEEEAWTYMHHPFTSPHPEDLPLLEKDPGRVRALAYDLVLNGVEVGGGSIRIHDPRLQARVFRLLGIGEEEQREKFGFFLEALEYGAPPHGGIAWGLDRLLALMTGSPSIREVIAFPKNKEGKDPLTGAPSPVPEEQLRELGLMVVRPLast
1 -200.0001efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model  100  1MRRTHYAGSLRETHVGEEVVLEGWVNRRRDLGGLIFLDLRDREGLVQLVAHPASPAYATAERVRPEWVVRAKGLVRLRPEPNPRLATGRVEVELSALEVLAEAKTPPFPVDAGWRGEEEKEASEELRLKYRYLDLRRRRMQENLRLRHRVIKAIWDFLDREGFVQVETPFLTKSTPEGARDFLVPYRHEPGLFYALPQSPQLFKQMLMVAGLDRYFQIARCFRDEDLRADRQPDFTQLDLEMSFVEVEDVLELNERLMAHVFREALGVELPLPFPRLSYEEAMERYGSDKPDLRFGLELKEVGPLFRQSGFRVFQEAESVKALALPKALSRKEVAELEEVAKRHKAQGLAWARVEEGGFSGGVAKFLEPVREALLQATEARPGDTLLFVAGPRKVAATALGAVRLRAADLLGLKREGFRFLWVVDFPLLEWDEEEEAWTYMHHPFTSPHPEDLPLLEKDPGRVRALAYDLVLNGVEVGGGSIRIHDPRLQARVFRLLGIGEEEQREKFGFFLEALEYGAPPHGGIAWGLDRLLALMTGSPSIREVIAFPKNKEGKDPLTGAPSPVPEEQLRELGLMVVRP 580
2 -173.0005w25_A mol:protein length:616 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  49  17VLRSHAAGLLREGDAGQQVTLAGWVARRRDHGGVIFIDLRDASGIAQVVFRDPTEVLAQAHRLRAEFCVSVAGVVEIRPEGNPEIATGEIEVNATSLTVLGECAPLPFQL--------DEPAGEELRLKYRYLDLRRDDPAAAIRLRSRVNAAARAVLARHDFVEIETPTITRSTPEGARDFLVPARLHPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVDAEDIIAISEEVLTELWALIGY-RIPTPIPRIGYAEAMRRFGTDKPDLRFGLELVECTDFFSDTTFRVFQAPYVGAVVMPGASQPRRTLDGWQDWAKQRGHRGLAYVLVAEDGGGPVAKNLTEAERTGLADHVGAKPGDCIFFSAGPVKSSRALLGAARVEIANRLLIDPDAWAFVWVVDPPLFEPADESGAWTAVHHAFTAPKPEWEDRIESDTGSVLADAYDIVCNGHEIGGGSVRIHRRDIQERVFAVMGLDKAEAEEKFGFLLEAFMFGAPPHGGIAFGWDRTTALLAGMDSIREVIAFPKTGGGVDPLTDAPAPITAQQRKESGIDAQPK 605
3 -172.0004rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  50  1MLRTHAAGSLRPADAGQTVTLAGWVARRRDHGGVIFIDLRDASGVSQVVFREGDV-LAAAHRLRAEFCVAVTGVVEVRPEGNPEIPTGQIEVNATELTVLGESAPLPFQL--------DEQAGEEARLKYRYLDLRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTLTRSTPEGARDFLVPARLQPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVEADDVIAISEQVLKAVWATIGY-DLPLPLPRISYEEAMRRFGSDKPDLRFGIELVECTEYFKDTTFRVFQAPYVGAVMPGGASQPRRTLDGWQEFAKQRGHKGLAYVLVGEDGGGPVAKNLSDAERDGLVAHVGANPGDCIFFAAGPAKGARALLGATRIEIAKRLLIDPNAWAFTWVVDFPMFEVAVGSGAWTAMHHAFTAPKPDSVDTFDSDPGNALSDAYDIVCNGNEIGGGSIRIHRRDIQERVFAMMGIDHDEAQEKFGFLLDAFSYGAPPHGGIAFGWDRITALLAGVDSIREVIAFPKSGGGVDPLTDAPAPITPQQRKESGIDAKPR 586
4 -171.0004o2d_A mol:protein length:620 Aspartate--tRNA ligase  ali model follow..  50  17VLRTHAAGSLRPADAGQTVTLAGWVARRRDHGGVIFIDLRDASGVSQVVFREGDV-LAAAHRLRAEFCVAVTGVVEVRPEGNPEIPTGQIEVNATELTVLGESAPLPFQL--------DEQAGEEARLKYRYLDLRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTLTRSTPEGARDFLVPARLQPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVEADDVIAISEQVLKAVWATIGY-DLPLPLPRISYEEAMRRFGSDKPDLRFGIELVECTEYFKDTTFRVFQAPYVGAVVMGGASQPRRTLDGWQEFAKQRGHKGLAYVLVGEDLGGPVAKNLSDAERDGLVAHVGANPGDCIFFAAGPAKGARALLGATRIEIAKRLLIDPNAWAFTWVVDFPMFDVAVGSGAWTAMHHAFTAPKPDSVDTFDSDPGNALSDAYDIVCNGNEIGGGSIRIHRRDIQERVFAMMGIDHDEAQEKFGFLLDAFSYGAPPHGGIAFGWDRITALLAGVDSIREVIAFPKSGGGVDPLTDAPAPITPQQRKESGIDAKPR 602
5 -168.0004wj3_M mol:protein length:599 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  47  3MMRSHYCGQLNESLDGQEVTLCGWVHRRRDHGGVIFLDVRDREGLAQVVFDPDRETFAKADRVRSEFVVKITGKVRLRPEGNPNMASGSIEVLGYELEVLNQAETPPFPL------DEYSDVGEETRLRYRFIDLRRPEMAAKLKLRARITSSIRRYLDDNGFLDVETPILGRPTPEGARDYLVPSRTYPGHFFALPQSPQLFKQLLMVAGFDRYYQIAKCFRDEDLRADRQPEFTQIDIETSFLDESDIIGITEKMVRQLFKEVLD-VEFDEFPHMPFEEAMRRYGSDKPDLRIPLELVDVADQLKEVEFKVFSGVPGAASMPRSQIDDYTKFVGIYGAKGLAYIKVNERAKGVEGLQSPIVKFIPEANLNVILDRVGAVDGDIVFFGADKAKIVCDALGALRIKVGHDLKLLTREWAPMWVVDFPMFEENDD--GSLSALHHPFTSPKCTPAELEANPGAALSRAYDMVLNGTELGGGSIRIHDKSMQQAVFRVLGIDEAEQEEKFGFLLDALKYGAPPHGGLAFGLDRLVMLMTGASSIREVIAFPKTQSAGDVMTQAPGSVDGKALRELHIRLREQ 589
6 -165.0001eqr_A mol:protein length:590 ASPARTYL-TRNA SYNTHETASE  ali model follow..  46  2..RTEYCGQLRLSHVGQQVTLCGWVNRRRDLGSLIFIDMRDREGIVQVFFDPDRDALKLASELRNEFCIQVTGTVRARDEKNRDMATGEIEVLASSLTIINRADVLPLDS--------NHVNTEEARLKYRYLDLRRPEMAQRLKTRAKITSLVRRFMDDHGFLDIETPMLTKATPEGARDYLVPSRVHKGKFYALPQSPQLFKQLLMMSGFDRYYQIVKCFRDEDLRADRQPEFTQIDVETSFMTAPQVREVMEALVRHLWLEVKG-VDLGDFPVMTFAEAERRYGSDKPDLRNPMELTDVADLLKSVEFAVFLRVPGGASLTRKQIDEYGNFVKIYGAKGLAYIKVNERAKGLEGINSPVAKFLNAEIIEDILDRTAAQDGDMIFFGADNKKIVADAMGALRLKVGKDLLTDESKWAPLWVIDFPMFEDDGE-GGLTAMHHPFTSPKDMTAAELKAAPENAVANAYDMVINGYEVGGGSVRIHNGDMQQTVFGILGINEEEQREKFGFLLDALKYGTPPHAGLAFGLDRLTMLLTGTDNIRDVIAFPKTTAAACLMTEAPSFANPTALAELSIQVVKK 586
7 -162.0004ah6_A mol:protein length:617 ASPARTATE--TRNA LIGASE, MITOCHONDRIAL  ali model follow..  43  9VVRTNTCGELRSSHLGQEVTLCGWIQYRRQNT---FLVLRDFDGLVQVIIPQDASVKKILCEAPVESVVQVSGTVISRPAGNPKMPTGEIEIKVKTAELLNACKKLPFEI------KNFVKKTEALRLQYRYLDLRSFQMQYNLRLRSQMVMKMREYLCNLGFVDIETPTLFKRTPGGAKEFLVPSR-EPGKFYSLPQSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVDQTGIQSLIEGLLQYSWPNDKD-PVVVPFPTMTFAEVLATYGTDKPDTRFGMKIIDISDVFRNTEIGFLQDALSKPHGTVAKYLKRKDIESIRNFAADHFNQEILPVFLNANWNSPVANFIMESQRLELIRLMETQEEDVVLLTAGEHNKACSLLGKLRLECADLLETRPTLFSFLWVVDFPLFLPKENPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILATLL---KEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFRGHDLMSNTPDSVPPEELKPYHIRVSKP 597
8 -122.0004up7_A mol:protein length:777 LYSINE--TRNA LIGASE  ali model follow..  19  30FNVSITVPEFIAQVSDDIVSVAGRVLSKRSSSSLMFIDLHDSQTKLQIMLNKSAY--ENKEDFVSLTKMIYRGDICGFTGHPTRTKTGELSLIPISGMILSPCLHMLPSMHYGLG-------DQETRFRKRYLDLINPESVKNFVLRTKVVKAVRKYLDDKGFLEVETPILNTIPGGATARPFITHHNQLDIQMYMRIAPELYLKELVVGGINRVYEIGRLFRNEGIDQTHNPEFTTCEFYMAYADYNDIMKMTEELLGNMVKD------------ITGGSTKLEIKDRLMDINNEEDIKMLEKFFKEPIPRPFNSAECSKV-------IEKHCTELNYYYDGNNEKAMKKLFADFVTEKKMVLDFTAPFKRISYVHALEEKFGEKIPRPLDGPEALTFLKKQAIRFNAICAEPQTTARVMDKLFGDLIEVDLVQPTFVCDQPQLMSPLAKY-----HRSEPELTERFELFILKREIANAYTELNNPIVQRSNFEQQAKGDDEAQLVDEVFLDAIEHAFPPTGGWGLGIDRLAMLLADVDNIKEVILFPTMRPEDELEKKAREAKEDAMVAQELAATEEK 590
9 -99.3003bju_A mol:protein length:521 Lysyl-tRNA synthetase  ali model follow..  20  31FHVDISLTDFIQKYTDITLKVAGRIHAKRASGKLIFYDLRGEGVKLQVMANSRNYKSE--EEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPHLHFGLK-------DKETRYRQRYLDLINDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVT--------------------------------------------------------------------------------------YHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEEKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPEDK........................ 510
10 -98.7005eln_A mol:protein length:535 Lysine--tRNA ligase  ali model follow..  20  40FKISMSLPAYALKYKDTTLSLSGRVTSIRSSSKLIFYDIFCEEQKVQIIANIMEHDIST-GEFSVSHSEIRRGDVVGFTGFPGKSKRGELSLFSKSVVLLSPCYHMLPTAISGLK-------DQEVRYRQRYLDLMNEESRKVFKLRSRAIKYIRNYFDRLGFLEVETPMLNMIYGGAAARPFITYHNELETQLYMRIAPELYLKQLIVGGLDKVYEIGKNFRNEGIDLTHNPEFTAMEFYMAYADYYDLMDLTEELISGLVLEIHGSLKIP--------------------------------------------------------------------------------------YHPDGPEGKCIEIDFTTPWKRFSFVEEIESGLGEKLKRPLDSQENIDFMVEMCEKHEIELPHPRTAAKLLDKLAGHFVETKCTNPSFIIDHPQTMSPLAKREKPEMTERFELFVLGKELCNAYTELNEPLQQRKFFEQQADGDVEACPIDETFCLALEHGLPPTGGWGLGIDRLIMFLADKNNIKEVILFPAMRNVKQNAQHSNQHSG.............. 528
11 -98.1005hgq_A mol:protein length:524 Lysine--tRNA ligase  ali model follow..  20  33FHVSISLADFIAKYNDIVQSVAGRVFSKRESGKLIFYDLHGEGTRLQVLANARFHSGD--EAFDNLHDRIKRGDIIGVNGYPARSKSGELSIIPYEIIQLTPCLHMLPHTHFGLK-------NQETRYRMRYLDLINPDVKNRFVTRSRMISFLRRYLDNLGFLEVETPMMNLIAGGATAKPFITHHNDLDMDLYLRVAPELYLKMLVVGGIDRVYEIGRVFRNEGIDQTHNPEFTSCEFYMAYADYEDLMKITEDMLARMVYYMHGTYK--------------------------------------------------------------------------------------QYHPNGIVENPVYEVDFTPPFRKVNIYDGLQEKLGIQFPPADTLDTDEKFFDKLAVENNVECPAPRTTARLLDKLIGEFLEPTFISPTFLTGHPQIMSPLAKRSIPGLTERFELFVVTKEIVNAYTELNDPLTQRLRFDEQAKGDDEAQNIDENYCTALEYGLPPTAGWGMGIDRLAMILTDSNNIKEVLFFPAMRPDEKGTNVLDEGGNA............. 524
12 -97.8006aqh_A mol:protein length:508 Lysine--tRNA ligase  ali model follow..  24  39VPRTHTLLEIRQAYTGEIVGVTGRVVFARNSGKLCFATLQEGDGQLQAMISLAEVGQEALDNWKT---YVDIGDIVFVHGEVITSKRGELSVLADSWQMAAKALRPLPVAHKEM--------SEESRVRQRYVDLIRDQARKVARQRIAVMRAIRSALERRGFLEVETPMLQTLAGGAAARPFVTHSNALDTELYLRIAPELFLKRCLVGGFERVFELNRVFRNEGADSTHSPEFVMLETYQAYGTYDDSAVVTRELIQEVADEAIG--------------------------------------------------------------------------------------------TRQVPLPDGTVYDLDGEWESIQMYPSLSEALGEEITPDTPAETLWAIADRLGLDIPRDRG--YGHGKLVEELWEHTVGAKLWAPTFVKDFPVETTPLTRRSIPGVTEKWDLYVRRIELATGYSELTDPIIQRERFEAQARGDDEAMALDEDFLAALEYGMPPSTGTGMGIDRLMMTLTGL-SIRETVLFPIVKPR.......................... 502
13 -97.1005vl1_A mol:protein length:506 Lysine--tRNA ligase  ali model follow..  25  36IERTHTLAEIRATYTEDIVGVAGRVVFARNTGKLCFATLQDGDGQLQAMISLDEVGRESLDRWKA---DVDIGDVVYVHGTVISSRRGELSVLADSWRMAAKALRPLPVAHKEM--------SEESRVRQRYVDLIRPQAREVARQRIAVIRAVRNALERRGFLEVETPMLQTLAGGAAARPFVTHSNALDIDLYLRIAPELFLKRCIVGGFDRVFELNRVFRNEGSDSTHSPEFSMLETYQTYGTYDDSALITRELIQEVADEAIG--------------------------------------------------------------------------------------------TRQLSMPDGSVYDIDGEWATMEMYSSLSEALGEQITPETTVARLRDIASGLDVEIDNSVF---GHGKLVEELWEHAVGNKLTAPTFVKDFPVETTPLTRRSIPGVTEKWDLYVRGVELATGYSELNDPVVQRDRFADQARGDDEAMQLDEDFLTALEYGMPPCTGTGMGIDRLLMCLTGL-SIRETVLFPIVRPHSN........................ 500
14 -96.6001e1o_A mol:protein length:504 LYSYL-TRNA SYNTHETASE, HEAT INDUCIBLE  ali model follow..  24  39FRRDHTSDQLHEEFLNIEVSVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDSLPEGVYNDQFKKWDL---GDIIGARGTLFKTQTGELSIHCTELRLLTKALRPLPDKFHGLQ-------DQEVRYRQRYLDLINDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVIPGGASARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYHDLIELTESLFRTLAQEVLG---------------------------------------------------------------------------------------------TTKVTYGEHVFDFGKPFEKLTMREAIKKYRPETDMADLDN---FDAAKALAESIGITVEKSWGLGRIVTEIFDEVAEAHLIQPTFITEYPAEVSPLARDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAERFQEQVNGDDEAMFYDEDYVTALEYGLPPTAGLGIGIDRMIMLFTNSHTIRDVILFPAMRPQK......................... 504
15 -96.1003a74_A mol:protein length:493 Lysyl-tRNA synthetase  ali model follow..  24  31FERTHKAEELFELYQQIEVAVAGRIMTKRGMGKAGFAHIQDVTGQIQIYVRQDDVGEQQYELFKISDL----GDIVGVRGTMFKTKVGELSIKVSSYEFLTKALRPLPEKYHGLK-------DIEQRYRQRYLDLINPESKKTFITRSLIIQSMRRYLDSHGYLEVETPMMHAVAGGAAARPFITHHNALDMTLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGISTRHNPEFTMLELYEAYADFRDIMKLTENLIAHIATEVLG---------------------------------------------------------------------------------------------TTKIQYGEHLVDLTPEWRRLHMVDAIKEYVGVDFWRQMSDEEARELAKEHGVEVAPHMT----FGHIVNEFFEQKVEDKLIQPTFIYGHPVEISPLAKPDDPRFTDRFELFIVGREHANAFTELNDPIDQRQRFEEQLKGNDEAHEMDEDFLEALEYGMPPTGGLGIGVDRLVMLLTNSPSIRDVLLFPQMRHK.......................... 493
16 -95.7001bbu_A mol:protein length:504 PROTEIN (LYSYL-TRNA SYNTHETASE)  ali model follow..  23  39FRRDHTSDQLHAEFLNIEVAVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDDLPEGVYNEQFKKWDL---GDILGAKGKLFKTKTGELSIHCTELRLLTKALRPLPDKFHGLQ-------DQEARYRQRYLDLINDESRNTFKVRSQILSGIRQFMVNRGFMEVETPMMQVIPGGAAARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESLFRTLAQDILG---------------------------------------------------------------------------------------------KTEVTYGDVTLDFGKPFEKLTMREAIKKYRPET---DMADLDNFDSAKAIAESIGIHVEKSWGLGRIVTEIFEEVAEAHLIQPTFITEYPAEVSPLARDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAQRFLDQVAGDDEAMFYDEDYVTALEHGLPPTAGLGIGIDRMVMLFTNSHTIRDVILFPAMRPVK......................... 504
17 -95.5001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  31  1MYRTHYSSEITEELNGQKVKVAGWVWEVKDLGGIKFLWIRDRDGIVQITAPKKPELFKLIPKLRSEDVVAVEGVVNFTPK-----AKLGFEILPEKIVVLNRAETPLP-----LDPTGKVKAELDTRLNNRFMDLRRPEVMAIFKIRSSVFKAVRDFFHENGFIEIHTPKIIATATEGGTELFPMKYF--EEDAFLAESPQLYKEIMMASGLDRVYEIAPIFRAEEHNTTRHNEAWSIDSEMAFIDEEEVMSFLERLVAHAINYVREHEPKLPFPRVSYDKALEILGDLGKEIPWGEDIDTEGE-----------------------------------------------------------------------------------------------------------------------------LLGKYMMENENAPLYFLYQYPSEAKPFKYDNKPEICRAFDLEYRGVEISSGGQREHRHDILVEQIKEKGLNPES----FEFYLKAFRYGMPPHGGFGLGAERLIKQMLDLPNIREVILFPRDRRRLTP....................... 438
18 -95.3004ex5_A mol:protein length:529 Lysine--tRNA ligase  ali model follow..  23  55FQPTHHAADLQTAYKSLEVAIAGRMMLKRVMGKASFATVQDGSGQIQFFVTPADVGAETYDAFKKWDL----GDIVAARGVLFRTNKGELSVKCTQLRLLAKALRPLPDKFHGLA-------DQETRYRQRYVDLITPETRTTFRARTKAIASIRKFMGDADFMEVETPMLHPIPGGAAAKPFVTHHNALDMEMFLRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRWLMDFTERLIRQAAVDALG---------------------------------------------------------------------------------------------TATIQYQGRELDLAQPFHRLTITQAIQKYAPSYDGQLSDDAFLRSELKRLGVDVTQPAFLNAGIGALQLALFEETAEAQLWEPTFIIDYPIEVSPLARDTVAGITERFELFITGREIANGFSELNDPEDQAARFKKQVEGDEEAMFFDADYIRALEYGMPPTGGCGIGIDRLVMLLTDSPTIRDVLLFPHLRRED......................... 523
19 -95.2004ycv_A mol:protein length:516 Lysine--tRNA ligase  ali model follow..  18  31FERTISIPEFIEKYEDTILNITGRIMRVSASGKLRFFDLVGDGEKIQVLANYSFHNHEKGNFAECYDKIRR-GDIVGIVGFPGKSKKGELSIFPKETILLSACLHMLPMKYG---------KDTEIRYRQRYLDLLNESSRHTFVTRTKIINFLRNFLNERGFFEVETPMMNLIAGGANARPFITHHNDLDLDLYLRIATELPLKMLIVGGIDKVYEIGKVFRNEGIDNTHNPEFTSCEFYWAYADYNDLIKWSEDFFSQLVYHLFGTYKIS--------------------------------------------------------------------------------------YNKDGPENQPIEIDFTPPYPKVSIVEEIEKVTNTILEQPFDSNETIEKMINIIKEHKIELPNPPTAAKLLDQLASHFIENKYNKPFFIVEHPQIMSPLAKRTKPGLTERLEMFICGKEVLNAYTELNDPFKQKECFKLQQKGDTEAAQLDSAFCTSLEYGLPPTGGLGLGIDRITMFLTNKNSIKDVILFPTMRPAN......................... 508
20 -95.2004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  22  61.....RVRDLTIQKADEVVWVRARVHTSRAKGKQCFLVLRQQQFNVQALVAVGDHASKQAANINKESIVDVEGVVRKVNQKIGSCTQQDVELHVQKIYVISLAEPRLPRPEAEGEEEGRATVNQDTRLDNRVIDLRTSTSQAVFRLQSGICHLFRETLINKGFVEIQTPKIISAASEGGANVFTVSYF--KNNAYLAQSPQLYKQMCICADFEKVFSIGPVFRAEDSNTHRHTEFVGLDIEMAFNYYHEVMEEIADTMVQIFKGLQER--------------------------------------------------------------------------------------FQTEIQTVNKQFPCEPFKFLEPTLRLEYCEALAMLREAGVEMGDEDDLSTPNEK---------------------LLGHLVKEKYDTDFYILDKYPLAVRPFPDPRNPKQSNSYDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEK----IKAYIDSFRFGAPPHAGGGIGLERVTMLFLGLHNVRQTSMFPRDPKRLTP....................... 515
21 -93.3001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  24  25.KRVKFVDLDEAKDSDKEVLFRARVHNTRQQGALAFLTLRQQASLIQGLVKANKEGTKWAGSLNLESIVLVRGIVKKVDEPIKSATVQNLEIHITKIYTISETPEALPRSEAEAEAAGLPVVNLDTRLDYRVIDLRTVTNQAIFRIQAGVCELFREYLATKKFTEVHTPKLLGAPSEGGSSVFEVTYF--KGKAYLAQSPQFNKQQLIVADFERVYEIGPVFRAENSNTHRHTEFTGLDMEMAFEEYHEVLDTLSELFVFIFSELPKRPKDGKMVRLTYKEGIE-----------------------------------------------------------------------------------------------------MLRAAGKEIGDFEDLSTENEKFLGKLVRDKYDTDFYILDKFPL-----------EIRPFYTMPDPAN---------PKYSNSYDFFMRGEEILSGAQRIHDHALLQERMKAHGLSPEDPG--LKDYCDGFSYGCPPHAGGGIGLERVVMFYLDLKNIRRASLFPRDPKRLRP....................... 490
22 -92.5001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  29  1MYRSHFIADVTPEYDGKEVIWAGWVHLLRDLGGKKFIILRDKTGLGQVVVDKNSSAFGISQELTQESVIQVRGIVKADKR-----APRGIELHAEEITLLSKAKAPLP-----LDVSGKVKADIDTRLRERVLDLRRQEMQAVIKIQSLALKAFRETLYKEGFIEIFTPKIIASATEGGAQLFPVIYF--GKEAFLAQSPQLYKE-LMAGVVERVFEVAPAWRAEESDTPFHAEFISMDVEMAFADYNDVMQLLEKILHNIVKTIKEEEVKIPIKRLKYTEAIEILRSKGYNIKFGDDIGT--------------------------------------------------------------------------------------------------------------------------------PELRILNEELKEDLYFIVDWPSDARPFSKSENPELSESFDLIYKFLEIVSGSTRNHKREVLEEALKKKGLKPES----FEFFLKWFDYGMPPHAGFGMGLARLMVMLTGIQSVKEIVPFPRDKKRLTP....................... 429
23 -91.9006chd_A mol:protein length:597 Lysine--tRNA ligase  ali model follow..  19  99FHVDISLTDFIQKYTDITLKVAGRIHAKRASGKLIFYDLRGEGVKLQVMANSRNYKSE--EEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPHLHFGLK-------DKETRYRQRYLDLINDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVT--------------------------------------------------------------------------------------YHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEEKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPEDKKENVATTDTLESTTVGTSV..... 597
24 -88.2001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  25  1MIEKVYCQEVKPELDGKKVRLAGWVYTNMRVGKKIFLWIRDSTGIVQAVVAKNVVGEETAKKLGRESSVIVEGIVKADER-----APGGAEVHVEKLEVIQAVSEFPIPENPE-------QASPELLLDYRHLHIRTPKASAIMKVKETLIMAAREWLLKDGWHEVFPPILVTGAVEGGATLFKLKYF--DKYAYLSQSAQLYLEAA-IFGLEKVWSLTPSFRAEKSRTRRHTEFWHLELEAAWMDLWDIMKVEEELVSYMVQRTLELNTEPPFPRISYDEAIDILQSKGVNVEWGDD---------------------------------------------------------------------------------------------------------------------------------LGADEERVLTEEFDRPFFVYGYPKHIKAFEDPNDPRKVLASDMLAGYGEIIGGSQREDDYDKLLNRILEEGMDPKD----YEWYLDLRRYGSVPHSGFGLGVERLVAWVLKLDHIRWAALFPRTPARLYP....................... 434
25 -87.6003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  20  14.VETPIVCNIRDGLEGKLVTFKGWAYHIRKARKLIFVELRDGSGYCQCVIFGKELCEEKVKLLTRECSLEITGRLNAYAGKNHPPEILNLEMQVTEWKVIGESPIDLENIINK-------DSSIPQKMQNRHIVIRSEHTQQVLQLRSEIQWYFRKYYHDNHFTEIQPPTIVKTQCEGGSTLFKLQYF--NEPAYLTQSSQLYLE-SVIASLGKSFCMLSSYRAEQSRTVRHAEYLHLEAELPFISFEDLLNHLEDLVCTVIDNVMAV------------------------------------------------------------------------------------------HGDKIRKMNPHLKLPTRPFKRMTYADAIKYCNDHGILNKDKPFEYGEDIS---------------------EKPERQMTDEIGCPIFMIHFPSKMKAFKVPGHPDLTESVDLLMPGVEIVGGSMRIWNYDELMGAYKANGLNPDP----YYWYTQQRKYGSCPHGGYGLGVERLVMWLLGEDHIRKVCLYPRYLERCEP....................... 456
26 -85.7001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  28  9...........KAHVGQEVELLGFLHWRRDLGRIQFLLLRDRSGVVQVVTGGL-------KLPLPESALRVRGLVVENAK-----APGGLEVQAKEVEVLSPALEPTPV-----IPKEEWRANPDTLLEYRYVTLRGEKARAPLKVQAALVRGFRRYLDRQDFTEIFTPKVVRAGAEGGSGLFGVDYF--EKRAYLAQSPQLYKQ-IMVGVFERVYEVAPVWRMEEHHTSRHNEYLSLDVEMGFIDEEDLMRLEEALLAEMLEEALNT------------------------------------------------------------------------------------------AGDEIRLLGATWPSFPQDIPRLTHAEAKRILKEELGYPVGQDLSEEAE-----------------------LLGEYAKERWGSDWLFVTRYPRSVRPFTYPEEDGTTRSFDLLFRGLEITSGGQRIHRYEELLESLKAKGMDPEA----FHGYLEVFKYGMPPHGGFAIGAERLTQKLLGLPNVRYARAFPRDRHRLTP....................... 422
27 -85.2005xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  22  39...........EGYRGQRVKVFGWVHRLRRQGKLMFLVLRDGTGYLQCVLADELCQCYNGVLLSTESSVAVYGMLNLTPKG--KQAPGGHELSCDFWELIGLAPAGGAD------NLINEESDVDVQLNNRHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAF--LTQSSQLYLE-TCLPALGDVFCIAQSYRAEQSRTRRHAEYTHVEAECPFLTFDDLLNRLEDLVCDVVDRILK-----------------------------------------------------------------------------------------SPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDV--------------------KKEDGTFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIKSFRCPEDSRLTESVDVLMNVGEIVGGSMRIFDSEEILAGYKREGIDPTP----YYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYPRFVQRCTP....................... 466
28 -83.7003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  20  47GLKYTEIEELVPAMAEKTVTIRARVQAVRGKGNMVFLFLRKGIYTCQALVMKSETISKEFQKISAESICDITGIVKAVEKPIEKATQQDVEIHVTSIAVVSLAEYPLPMQIEDLTFPSSVKVSQDTRLDNRMLDLRTVTNIAIFRIQSACCGLFREFLTSQKFVEIHTPKLIGCSSEGGSNIFEVKYF--DRKAYLAQSPQLYKQMAIMGDFRKVFEVGPVFRAENSNTRRHTEFEGLDIEMEIVNYHECIDVMEKLFTFIFDEIPKRLIYRPFLRLTYKEAIE-----------------------------------------------------------------------------------------------------MLRASGETIGDYDDFTTPQEV-----------------------KLGELIKAKYNTDFYILDKFPAAIRPFPDIDDPNYSNSYDVFVRGQEITSGAQRIHDPEFLMKRCIEKGVDPAT----LKDYIESFRFGSWPHAGCGIGLERITMLYLGIPNIRKVTLFPRDPIRLNP....................... 548
29 -83.2002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  24  9...........VKHRNERVCIKGWIHRMRRQGKLMFFILRDGTGFLQVLLMDKLCQTYDALTVNTECTVEIYGAIKEVPEG--KEAPNGHELIADFWKIIGNAPPGGID------NVLNEEASVDKMLDNRHLVIRGENAAALLRLRAAATRAMREHFYNAGYVEVAPPTLVQTQVEGGSTLFNLDYFGEQSF--LTQSSQLYLETC-IPTLGDVFCIAQSYRAEKSRTRRHAEYAHVEAECPFITLDDLMEKIEELVCDTVDRLLADPPERPFLRMEYKDAIKWLQEHNVENEFGNTF---------------------------------------------------------------------------------------------------------------------------TYGEDIAEAAERFMTDTINKPILLNRFPSEIKAFRDAKDNTLTESVDLLMPGVEIVGGSMRIWKFDELSKAFKNVEIDPKP----YYWYLDQRLYGTCPHGGYGLGLERFICWLTNTNHIRDVCLYPRFVGRCVP....................... 437
30 -72.8003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  23  4.........................................................................................................................SSSGLVPRGSHMSEQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIETRFVGPGHSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCP-------AAESLSYQQAFLRYLEIDP--------------------------------------------------------------------------------------------------------LSADKTQLREVAAKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGKEKPTFVYHFPASQASLAQTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDNRRGLPQHPIDQNLIEALKVGMPDCSGVALGVDRLVMLALGAETLAEVIAFSVDRA........................... 339
31 -69.0003g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  22  9.......................................................................................................................................QPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIETRFVGPGHSQGINLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCQ-------PAESLSYQQAFQRHLE--------------------------------------------------------------------------------------IDPLSADKTQLREAAAKLDLSNIADTEEDRDTLLQLLFTMGVE------------------PHIGKEKPTFIYHFPASQASLAQTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDNRRGLPQQPIDQNLLDALAAGLPDCSGVALGVDRLVMLALGAESLADVIAFTVDRA........................... 326
32 -64.9003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein  ali model follow..  23  2..................................................................................................................................NAVEIISRDIYKAIDIQTKILDYMTKFFTDRGFKWLLPIMLSPITPDPAGEGIRPAEVD-GVRMRLTHSMILHKQLAIAMGLEKIFVLSPNIRLESRRKDHSYEFTQLDFEIEGAKMKDVMRLIEELIYGLFRKAEEWPRARHFKVYDYKDILEEFGSDEKASM------------------------------------------------------------------------------------------------------------------------------------------------EMEEPFWIVNIPREFYDREEN-GVWKNYDLILPYGYGEVSSGGEREWEYEKIVAKIRAAGLKEDS----FRPYLEIARAGLKPSAGAGIGVERLVRFIVGAKHIAEVQPFPRVPGIPAVI...................... 294
33 -61.2001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  24  2..................................................................................................................................NAVEIISREISPTLDIQTKILEYMTDFFVKEGFKWLLPVIISPITPDPAGEGMEPAEVE-GVKMRLTHSMILHKQLAIAMGLKKIFVLSPNIRLESRQKDHAYEFTQLDFEVERAKMEDIMRLIERLVYGLFRKAEEWPKTKRFEVFEYSEVLEEFGSDEKASQ------------------------------------------------------------------------------------------------------------------------------------------------EMEEPFWIINIPREFYDREVDGFWR-NYDLILPYGYGEVASGGEREWEYEKIVAKIRKAGLNEDS----FRPYLEIAKAGLKPSAGAGIGVERLVRFIVGAKHIAEVQPFPRIPGIPAVI...................... 294
34 -46.7004lns_A mol:protein length:351 Asparagine synthetase a  ali model follow..  14  4.................................................................................................................................DGYSSYVL-LQEQILTVKRSFSEALEKEL---NLVEVRAPILFRVGDGTQDNLSVPVKAIPNASFEVVHSLAKWKRRTLFAPGHGLYTHMTALRDDVLDNIHSVVVDQWDWEMVMKDDQRNLAFLKEVVCKVYAAIRKTE--------------------------------------------------------------------LAVCEKYKQKPILPETIQFVHAEHLLLAYPNLTAKEREREIAREYGAVFLIGIGAVLSSGDRHDARAPDYDDWTSPVEASQVVFPRTSKPIPTMNSLSSLKGL--------------------NGDILLYNPTLDDSLEVSSMGIRVNAEALRHQ----ISLTGDDSLLKSEWHQQLLNGEFPQTVGGGIGQSRMVMFMLRKKHIGEVQCWPEEIRKKHNLL..................... 351
35 -45.60011as_A mol:protein length:330 ASPARAGINE SYNTHETASE  ali model follow..  14  1...........................................................................................................................................MKTAYIAKQRQISFVKSHFSRQGLIEVQAPILSRVGDGTQDNLSVKVKALPDAQFEVVHSLAKWKRQTLFSAGEGLYTHMKALRDEDRLSPLH-YVDQWDWERVMGDGERQFSTLKSTVEAIWAGIK--------------------------------------------------------------------ATEAAVSEEFGLAPFLPDQIHFVHSQELLSRYPDLDAKGRERAIAKDLGAVFLVGIGGK-----------------------------------LSDGHRHDVRAPDYDDWSTPSELGHAGLNGD----ILVWNPVLEDAFELSSMGIRVDADTLKHQLALT----GDEDRLELEWHQALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQAWPAAVRESVP....................... 327
36 -45.2005gro_A mol:protein length:115 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  47  6.MRSHFCTEISEKDVGKIVKVAGWCNTYRDHGGVVFIDLRDKSGLVQLVCDPSSKAYEKALEVRSEFVLVAKGKVRLRGAGNPKLKTGKIEIVLEELIIENKS............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 109
37 -40.6004gn5_A mol:protein length:113 OBody AM3L15  ali model follow..  25  4.KKTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERHLFKVFAELSREDVVVIKGIVEAGWPVA---LDTGVEIFPSEIWILNKAKPLPID....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 113
38 -39.8004gn4_B mol:protein length:108 OBody AM2EP06  ali model follow..  25  5.KKTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLEDHLFKVFAELSREDVVVIKGIVEASEQYGS---ATGVEIFPSEIWILNKA............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 108
39 -39.7004gla_C mol:protein length:109 OBody NL8  ali model follow..  25  6.KKTHWTAEITPNLHGTEVVVAGWVASLGDYGRVKIVKVSDREGGAAVPVYLEAHLFKVFAELSREDVVVIKGIVEASK-----GVGRGVEIFPSEIWILNKAKA........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 109
40 -39.6004gn3_B mol:protein length:113 OBody AM1L10  ali model follow..  27  8.KKTHWTAEITPNLHGTEVVVAGWVASLGDYGRVKIVKVSDREGGAAVSVYLEDHLFKVFAELSREDVVVIKGIVEASK-AAADMHNG-VEIFPSEIWILNKAK............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 113
41 -39.3004glv_B mol:protein length:107 OBody AM3L09  ali model follow..  25  4.KKTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLEDHLFKVFAELSREDVVVIKGIVEATTVTRW---DTGVEIFPSEIWILNKA............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 107
42 -37.5002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  17  1......................................................MGSSSSGLVPRGSHMFLTRRDPPLSTKVQYQRLKELNASGEQLEMGFSDALSRDRAFQGIE-------HQLMSQGKRHLELRTVKHRPAL---LELEEKLAKALHQQGFVQVVTPTILAKMTIGEDHPLFSQVFWLDGKKCLRLAPNLYTLWRLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAA........................................................................................................................................................................................................................................................................................................................... 216
43 -27.2004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  16  8....................................................................LVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGKPF----------RELESELLSRRKKDLQQIYAE--ERENYLGKLEREITRFFVDRGFLEIKSPILIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLGNYLLPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGRENLESIITDFLNHL............................................................................................................................................................................................................................................................................................................................... 201
44 -27.2002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  16  11.......................................................................RGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGKPF----------RELESELLSRRKKDLQQIYAE--ERENYLGKLEREITRFFVDRGFLEIKSPILIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLLPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCENLESIITDFLNHL............................................................................................................................................................................................................................................................................................................................... 201
45 -25.8004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  17  11.......................................................................RGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGKPF----------RELESELLSRRKKDLQQIYAE--ERENYLGKLEREITRFFVDRGFLEIKSPILIERMGIDNDTELSKQIFRVDKNFCLRLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLSFIQMGSGRENLESIITDFLNHL............................................................................................................................................................................................................................................................................................................................... 201
46 -23.1003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  16  5....................................................................LVPRGSHGASAPALTKSQTDRLEVLLNPKDEISLNS------------GKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIERMGIDNDTELSKQIFRVDKNFCLRLTPNLYNYLRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLVFWQMGSGRENLESIITDFLNHL............................................................................................................................................................................................................................................................................................................................... 198
47 -22.1005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  16  3..........................................................................................ALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAE--ERENYLGKLEREITRFFVDRGFLEIKSPILIERMGIDNDTELSKQIFRVDKNFCLRLAPNLYNYLRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLAFAQMGSGRENLESIITDFLNHL............................................................................................................................................................................................................................................................................................................................... 184
48 -21.4004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  16  23..................................................................................................................LNSGKPFRELESELLSRRKKDLQQIYEERENYLGKLEREITRFFVDRGFLEIKSPILIERMGIDNDTELSKQIFRVDKNFCLRVAPNIFNYARKLDR--KIFEIGPCYRKESDGKEHLEEFTMLNFFQM-CTRENLESIITDFLNHL............................................................................................................................................................................................................................................................................................................................... 183
49 -20.4004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  17  16.................................................................................................................LNPKDEISLNSGKPFRELESELLSRRKKERENYLGKLEREITRFFVDRGFLEIKSPILIERMGIDNDTELSKQIFRVDKNFCLRLAPNLANYLRKLD---KIFEIGPCYRKESDGKEHLEEFTMLNFCQSGCTRENLESIITDFLNHL............................................................................................................................................................................................................................................................................................................................... 184
50 -13.1003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  13  1......................................................................................................................SNAMAKNDKINFSTPSGFPEFLPSEKRLELYLLDTIRRVYESYGFTPIETPALEPILPPNRQAEKDKSGDTGSEARALKFDQTVPLAAYIARHLNARYQMDVVFRGERAKDGRFRQFRQCDIDVVGREKLSLLYDAQMPAIIT-------------------EIFEAVNIGDFVIRIN---------------------------------NRKVLTGFFQSLNISETQIKSCISIIDNLEKIGEAKVKLELEKEGINPEQTQKIIDFVKIDGSVDDVLDKLKHLSQTLPESEQFNLG-----------------------------VSELETVITGVRNLGVPDKRFCIDLIARGLNYYTGTV-----------YETTLIGHEALGSRYEELVGTFIGEKMPGVGISIGLTRLISRLLKAGILNQVVVVNMQDELMPTYLKVSQQLRQAGLN......... 400
51 -12.7003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  11  10....................................................................................................................TQGPGSMQMNMVETEPVQGCRDFPPETMRLRKYLFDVFHSTARKFGFEEYDSPLYIRKAGEEITEQMFNFITKGGHRVALPEMTPSLARQLLAKGRSKWYSIPQCWRYEAITRGRRREHYQWNMDISVSSEVELVCAACTAMQSLGLSSKDVGVKINSRKIL-QTVVEQAGVSADKFAPVCVIVDKMEKLPREEVVAQLAAIGLE----------------------------------------------SNVVDAITSTLSLKTIDEIAQRIGEEHEAVRELRDFITQIEAYGFGDWVIFDASVVRGLAYYT----------------------------------GIVFEGFDRDGNLCGGG-------------------------RYDNLLTTYGSPTAPCVGFGFGDCVIVELLNEKKLLPDDLVIPFDETMRPHALSILRRLRDAGRS......... 384
52 -12.6001nnx_A mol:protein length:109 Protein ygiW  ali model follow..  17  24..SVTTVESAKSLRDDTWVTLRGNIVERISDDLYVF---KDASGTINVDIDHKRWNG---VTVTPKDTVEIQGEV--------DKDWNSVEIDVKQIRKVNP.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 109
53 -12.4003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  11  8..................................................................................................................AQTQGPGSMQKNMVETEPVQGCRDFPPEAMRCRRHLFDVFHATAKTFGFEEYDAPLYIRKAGEEITEQMFNFITKGGHRVALPEMTPSLARLLLGKGRSKWYSIPQCWRYEAITRGRRREHYQWNMDISVSAEVELVCAACWAMRSL-----------------------------SSKDVGIKVNSRKVLQTVVEQAGVTSDKFAPVCVIVDKMEKIPREEVEAQLAVLGLEPT--------------------VVDAITTTLSLKSIDEIAQRVGEEHEAVKELRQFFEQVEAYGYGDWVLFDASVVRGLAYYT----------------------------------GIVFEGFDREGKFGGG--------------------------RYDNLLTTYGSPTPPCAGFGFGDCVIVELLQEKPHVVDDVVIPFDESMRPHALAVLRRLRDAGRS......... 384
54 -12.1002j3l_A mol:protein length:572 PROLYL-TRNA SYNTHETASE  ali model follow..  14  14..................................................................................................................VPNDAEVLSHQILLRAGYIRQVAAGIYSYLRVLEKLKTIMREEFEKIDAVEMLMPALLPAE-ETYGPNLYRLKDRNDRDYILGPTHEETFTELIRDEINSYYQIQTKYRDE-----RGREFIMKDGYSFHADEASLDQSYRDYEKAYSRIFERCGLE-----FRAIIGDGGAMGGKDSKEFMAISEIGEDTICYSTESDYAANLEMATSLYTPKKSHETQLDLEKIATPEVGTIAEVANFFEVEPQRIIKSVLFIADEEPVMVLVRGDHDVNDVKLKNFLGADFLDEATEEDARRVLGAGFGSIGPVNVSEDVKIYADLAVQDLANADRDFQPISYEDLRFVQEGDPSPDGNGVLAFTKGIEIG-------------HIFK---LGTRYSDAMGATVLDENGREKSVIMGYGIGVSRLLSAIVEQNADERGINWPTG---------APFDLH-AMMTEAGYEVL.. 504
55 -11.9003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  13  1..............................................................................................................SNAMNGTRSAWGARAWEAVRGFADRMQDGYPDFAKRRRAVETRLLSFVEDAGYEPVTSGTLLRARSPESSRDWIRLFDGGGDAVALRPEMTPSIARMAAPRVARWCYCERVYRRTDDPASLSWESTQVGIER--IGEEASVDVDMDVLRLLHEASAAAGVRHHRIVVSHARLVP-------------------RLLDALGISASLSRAFLACLTSGNYVQFRELWQLHAAKDVDLLANLLTWSPAERDAAKRSREASDRELEALLRDAVDPRAAADVRDA-------------------------------------------------------WRYLCRLAEALHDSGLASDVVTFDLLHRELDYYTGLV-----------FEMFAPGVGAPIAQGGRYDELLAFGAGPAVGFAFEVERVMAVLEAQEEGEG.................................... 371
56 -11.5005ucm_A mol:protein length:579 Proline--tRNA ligase  ali model follow..  12  17...................................................................................................................PADAVVISHQLLLRAGMIRRLASGLYTWLRVLRKVETIVREEMNAAGALEVLMPAVQPAE-EQYGPELLRLKDRHEREFCVGPTHEEVITDLARNELNSYYQIQTKFRDE-----RGREFIMKDAYSFHLSQDSLQQTYDGMYQAYSKIFSRLGLD-----FRPVQADNGSIGGSGSHEFHVLANSGEDDIVFSDSSDYAANIEKAEAVPRESARGSATEDMRLVDTPNTKTIAALVDGFQLPIEKTIKTLVVHGAEEGTLVALIVRGDHELNEIKAANQPLVASPLVFASEAEIRAAIGAGPGSLGPVNLPIACIVDRSVA-VNWERDLPLPEVADLRNVVEGDPSPDGKGTLVIKRGIEVGHIFQ----------------LGTKYSEAMKLSVLSEQGKPVNLIMGYGIGVSRVVAAAIEQNHDERGILWPSA---------APFQI............... 476
57 -11.5004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  10  2.....................................................................................................................PGSEFELRRQFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMN--KRYHIAKVYRRDAMTRGRYREFYQCDFDIPMIPDAECLKIMCEILSSL--------------------------------------------------------------------------QIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDDKISFDL---------------LARGLDYYTGVI-----------YEAVLLQTPAQAGEEPLGVGSVAAG--PCVGLSIGVERIFSIVEQRTTETQVLVASAQKKLLEERLKLVSELWDAGIK......... 395
58 -11.4004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  10  8...........................................................................LRRQMAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKE-GEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMN--KRYHIAKVYRRDAMTRGRYREFYQCDFDIPMIPDAECLKIMCEILSSL--------------------------------------------------------------------------QIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDDKISFDL---------------LARGLDYYTGVI-----------YEAVLLQTPAQAGEEPLGVGSVAAG--PCVGLSIGVERIFSIVEQRTTETQVLVASAQKKLLEERLKLVSELWDAGIK......... 448
59 -11.1001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  11  3..............................................................................................................................RLQIEKIRGFRDFYPEDMDVEKFIFKTAEEAAEAFGFRRIDFPSLRIKSGEELLQQTYSFVDKGGREVTLIATPSTVRMVTSRKDLQRWYSFPKVWRYEEPQAGRYREHYQFNADISPEADAEVIALASSILDRL--------------RINSRKIMEEIIGGMTSSDPFSVFSIIDRYHKISREEFVDQLRSAGIGEDGVSMIADLCSGTRGIDEMARITGK------------------------------------------------------------------------------------------------SSEEIARMAAVEDLLASYGVKNVRYIVRGLSYYTGIV-----------FEAYDRSGQFRAGRYDNLASLMSGESVPAVGFGMGDAVISLLLKREREKKSVYICRVGKINSSIMNEYSRKLRERGMN......... 361
60 -10.1003od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  12  17........................................................................................................................................RDTLPEWYKTKKNICDQMTEEINLWGYDMIETPTLVGVVSAILDQQLFKLLDQQGNTLVLRPDMTAPIARLVASSLKRLAYQSNVYRAQQNEGGKPAEFEQLGVELTASADGEVIALMIAALKRA--------------------------------EFKVAIGHVGYVNALLMDVVGNEQRADRLRRFLYEKNYVGYREHVKSLNLSTIDKSRLMNLLSLRGGRAAIEEARGLIQTEKGKTALAE-----------------MTKLYEVLESYGASEYVKFDLTLVLHMSYYT----------------------------------GVVFEGYGNGVPLCSGG-------------------------RYDELLS--KFHRPQATGFGVRIDLLVEALNGEIISNGCILFSNERRFEAIEL-------ARKKRANGEAVV.. 366
61 -9.8803kf6_A mol:protein length:159 Protein stn1  ali model follow..  19  48................RWIQIVGYIAAIDIYEGKHVLTVDDCSGMVLRVVQDDFSMSKRAISMSPGNVVCVFGKI--------NSFRSEVELIAQSFEELRDPN------------DEWKAWQKRMRYKKNLTKISKN.......................................................................................................................................................................................................................................................................................................................................................................................................................................................... 152
62 -9.7904rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  14  2..............................................................................................................................PMTARAVRGTKDLFGKELRMHQRIVATARKVLEAAGALELVTPIFEETATDIVRKEMFTFQDRGGRSLTLPEGTAAMVRAYLEHGMKRLWMAGPMFRAERPQKGRYRQFHQVNYEALGSENPILDAEAVVLLYECLKELGLRRLKVKLSSVGDPEDRARY--------------------------------------------------NAYLREVLSPHREALSEDSKERLELNPMRILDSKSERDQALLKELGVRPMLDFLGEE--ARAHLKEVERHLERLSVPYELEPALVRGLDYYVRTAFEVHHE-------------------------------EIGAQSALGGGG--------------------------RYDGLSELLGGPRVPGVGFAFGVERVALALEAEEKGPDLYLIPLTEEAVAEAFYLAEALRPRLRAEYALAPRK. 367
63 -9.7904e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  14  3..........................................................................................................MGTLEAQTQGPGSMTEQKRKLEKLTGVKGMNDILPQDAGLWEFFEATVKSLLRAYGYQNIRTPIVEHTP--GEVTDIVEKEMYSGENLTLPENTAAVVRAAIEHNMLRLWYIGPMFRHERPQRGRYRQFHQVGVEALGFAGPDADAEIVMMCQRLWEDLGLTGIKLEINSLGLAEERAAH-------------------------------------------------------------------------RVELIKYLEQHADKLDDDAQRRLYTNPLRVLDTKNPALQEIVRNAPKLIDFLGDVSRA------------HFEGLQRLLKANNVPFTIN-----PRLVRGLDYYNLTVFEWVTDKLTVAAGG-------------------------RYDPLIEQLGGKPTAACGWAMGIERILELLKEEHLVPDVYVVHQGDAAREQAFIVAERLRDTGLD......... 377
64 -9.7702el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  13  5..........................................................................................................................QDPMAKNIQAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTVTDVVEKEMYTFEDRNGDSLTLPEGTAGCVRAGIEHGLLRLWYIGPMFRHERPQKGRYRQFHQLGCEVGPDIDAELIMLTARWWRAL-----------------------------------------------------------------------------------GISEHVTLELNSIGSLEARANYRDALVAFLEQHKEKLDEDCKRRMYTNPLRVLDSKNPEVQALLNDAPA---------LGDYLDEESREHFAGLCKLLESAGIAYTVNQR-LVRGLDYYNRTVFEWVTNSLTVCAGG-------------------------RYDGLVEQLGGRATPAVGFAMGLERLVLLVQAVDPVVDIYLVASGADTQSAAMALAERLRDEL........... 362
65 -9.7001z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  10  3....................................................................................................................GSGSIEGRMEKINYLLPEESAEMTLNQVKSLRQIEGRLRKLFSLKNYQEVMPPSFESNGKTFNQEKMFQFIKHEGQSITLR--YDFTLPLVRLYS--RYSYFGKIFRKEKRHKGRSTENYQIGIELADKSELEILSLALQVIEQL--------------------------------KTVFEIGSAK-------FQRLCQLADGSTELLTELLLKKDLSGLNAFIEKNNFSKELRGLLKEIFITNELSRLENLVTNTKDD------------------VLISSFDQLKEFSEKLSMIKPIIIDLGMVPKMDYYT----------------------------------DLMFKAYSSAANLSGG--------------------------RYDQLLS--NFQEEFAIGFCCHMDTILKALERQELEED.................................... 336
66 -9.5103l4g_A mol:protein length:508 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  14  25........ELAAELGMEHQAVVGAVKSLQALGEVIEAELRSTK-HWELTAEGEEIAREGSHEARVFRSIPPEGLAQSELMRLPSGKVGFSKAMSNKWIRVDKSAADGPRVFRVVDSMEDEVQRRLQLVRGGQAEKLGEKERSELRKRKLLAEVTLKTYWVSKGSAFSTSIETELSPEMISS-AHGVLPDSGHLHPLLKVRSQFRQIFLEMGFTEMPTIESSFWNFDA-PQQHPARDQHDTF--FLRDPAEALQLPM---DYVQRVKRTHSQGGYGSQGYKYNWKLDEARKNLLRTHTTSASARALVKYFSIDRVFRNETLDATHLAEF----------------------------------------HQIEGVVADHGLTLGHLM------------------------------------VLREFFTKLGITQLRFKPAYNPYTEP----------------SMEVFSYHQGVEVGNSGV------FRPEMLLPMGLPEN---------VSVIAWG--------LSLERPTMIKYGINNIRELVGYDSPLCRLDAEPRPPP................. 503
67 -9.4401qe0_A mol:protein length:420 Histidine--tRNA ligase  ali model follow..  11  9........................................................................................................................................QDILPEDSKKWRYIENQLDELMTFYNYKEIRTPIFESTSTDVVQKEMYTFKDKGDRSITLPEGTAAVVRSYIEHKM-KLYYNGPMFRYERKQKGRYRQFNQFGVEAIGAENPSVDAEVLAMVMHIYQSFGLKHLKLVINSVGDMASRKEY-------------------------------------------------------------------------NEALVKHFEPVIHEFCSDCQSRLHTDPMRILDCKVDRDKEAIKTAPRITDFLNEESKA------------YYEQVKAYLDDLGIPYTED-----PNLVRGLDYYTHTAFELMMDNPNYDGAITTL-------------------GGGRYNGLLELLDGPSETGIGFALSIERLLLALLDIEENLDLFIVTMGDQADRYAVKLLNHLRHNGIK......... 358
68 -9.3306FTT Entity 1(prereleased)  ali follow..  12  8........................................................................................................................................ADVLFEDAHKQEVLRHQLTQQLITHGYQLVSPPMISGASEDLKRQTFKIIDQLTGRLMGIR--ADITPQILRIDAHHRYCYAGDVIHTLPSGLFGSRTPLQLGAEIIAADIELIDVLFSMINSLDMSAVLHVDLGHVTIFKRLAELAALSASDTEQLMQLYANKNLPELKQVCQ-------------------VLPMGSDFYTLARFGHDIANLLGRLSENAQQDTKIVTAIDELQRLKAHLQVQWQCAVSIDVTELSGYHYHTGIV----------------------------------------------------------------FNGYINSEPLVRGG-------------------------RFDGMKSNQATNQPQATGFSMDVSRLLAHTQLDAPFIVLIDYDAFNNLDSAQRQLLLQQV-ASLRQQGYRVT.. 360
69 -9.3305m8h_A mol:protein length:388 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  12  8........................................................................................................................................ADVLFEDAHKQEVLRHQLTQQLITHGYQLVSPPMISGASEDLKRQTFKIIDQLTGRLMGIR--ADITPQILRIDAHHRYCYAGDVIHTLPSGLFGSRTPLQLGAEIIAADIELIDVLFSMINSLDMSAVLHVDLGHVTIFKRLAELAALSASDTEQLMQLYANKNLPELKQVCQ-------------------VLPMGSDFYTLARFGHDIANLLGRLSENAQQDTKIVTAIDELQRLKAHLQVQWQCAVSIDVTELSGYHYHTGIV----------------------------------------------------------------FNGYINSEPLVRGG-------------------------RFDGMKSNQATNQPQATGFSMDVSRLLAHTQLDAPFIVLIDYDAFNNLDSAQRQLLLQQV-ASLRQQGYRVT.. 360
70 -9.0801b70_A mol:protein length:350 PHENYLALANYL-TRNA SYNTHETASE  ali model follow..  16  10...................................................QNARDLEELKALKARY-LGKKGLLTQEMKGLSALPLEERRKRGQELNAIKAALEAALE-----REKALEEAALKEALERERVDVSLPGASGGLHPITLMERELVEIFRALGYQAVEGPALNIPEHHPARDFWLTGEVEGRLLLRTHTSPMQVRYMVAHTPPFRIVVPGRVFRFEQTDATHEAVFHQLE-----IAMAHLKGAIYELAQALFGPDSKVRFQPVYFPFVEPGA.......................................................................................................................................................................................................................................................................................................... 265

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 6 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Awobuluyi M, Yang J, Ye Y, Chatterton JE, Godzik A, Lipton SA, Zhang D. Subunit-specific roles of glycine-binding domains in activation of NR1/NR3N-methyl-D-aspartate receptors. Mol Pharmacol. 2007 Jan;71(1):112-22. Epub 2006 Oct 17.