current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 1eqr_A mol:protein length:590 ASPARTYL-TRNA SYNTHETASE, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590
# Score Template Links and tools%idFirst MRTEYCGQLRLSHVGQQVTLCGWVNRRRDLGSLIFIDMRDREGIVQVFFDPDRADALKLASELRNEFCIQVTGTVRARDEKNINRDMATGEIEVLASSLTIINRADVLPLDSNHVNTEEARLKYRYLDLRRPEMAQRLKTRAKITSLVRRFMDDHGFLDIETPMLTKATPEGARDYLVPSRVHKGKFYALPQSPQLFKQLLMMSGFDRYYQIVKCFRDEDLRADRQPEFTQIDVETSFMTAPQVREVMEALVRHLWLEVKGVDLGDFPVMTFAEAERRYGSDKPDLRNPMELTDVADLLKSVEFAVFAGPANDPKGRVAALRVPGGASLTRKQIDEYGNFVKIYGAKGLAYIKVNERAKGLEGINSPVAKFLNAEIIEDILDRTAAQDGDMIFFGADNKKIVADAMGALRLKVGKDLGLTDESKWAPLWVIDFPMFEDDGEGGLTAMHHPFTSPKDMTAAELKAAPENAVANAYDMVINGYEVGGGSVRIHNGDMQQTVFGILGINEEEQREKFGFLLDALKYGTPPHAGLAFGLDRLTMLLTGTDNIRDVIAFPKTTAAACLMTEAPSFANPTALAELSIQVVKKAENNLast
1 -190.0001eqr_A mol:protein length:590 ASPARTYL-TRNA SYNTHETASE  ali model  100  1MRTEYCGQLRLSHVGQQVTLCGWVNRRRDLGSLIFIDMRDREGIVQVFFDPDRADALKLASELRNEFCIQVTGTVRARDEKNINRDMATGEIEVLASSLTIINRADVLPLDSNHVNTEEARLKYRYLDLRRPEMAQRLKTRAKITSLVRRFMDDHGFLDIETPMLTKATPEGARDYLVPSRVHKGKFYALPQSPQLFKQLLMMSGFDRYYQIVKCFRDEDLRADRQPEFTQIDVETSFMTAPQVREVMEALVRHLWLEVKGVDLGDFPVMTFAEAERRYGSDKPDLRNPMELTDVADLLKSVEFAVFAGPANDPKGRVAALRVPGGASLTRKQIDEYGNFVKIYGAKGLAYIKVNERAKGLEGINSPVAKFLNAEIIEDILDRTAAQDGDMIFFGADNKKIVADAMGALRLKVGKDLGLTDESKWAPLWVIDFPMFEDDGEGGLTAMHHPFTSPKDMTAAELKAAPENAVANAYDMVINGYEVGGGSVRIHNGDMQQTVFGILGINEEEQREKFGFLLDALKYGTPPHAGLAFGLDRLTMLLTGTDNIRDVIAFPKTTAAACLMTEAPSFANPTALAELSIQVVKKAENN 590
2 -180.0004wj3_M mol:protein length:599 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  61  4MRSHYCGQLNESLDGQEVTLCGWVHRRRDHGGVIFLDVRDREGLAQVVFDPDRAETFAKADRVRSEFVVKITGKVRLRPEGARNPNMASGSIEVLGYELEVLNQAETPPFPLYSDVGEETRLRYRFIDLRRPEMAAKLKLRARITSSIRRYLDDNGFLDVETPILGRPTPEGARDYLVPSRTYPGHFFALPQSPQLFKQLLMVAGFDRYYQIAKCFRDEDLRADRQPEFTQIDIETSFLDESDIIGITEKMVRQLFKEVLDVEFDEFPHMPFEEAMRRYGSDKPDLRIPLELVDVADQLKEVEFKVFSGPANDPKGRVAALRVPGAASMPRSQIDDYTKFVGIYGAKGLAYIKVNERAKGVEGLQSPIVKFIPEANLNVILDRVGAVDGDIVFFGADKAKIVCDALGALRIKVGHDLKL-LTREWAPMWVVDFPMFEE-NDDGSLSALHHPFTSPKCTPAELEANPGAALSRAYDMVLNGTELGGGSIRIHDKSMQQAVFRVLGIDEAEQEEKFGFLLDALKYGAPPHGGLAFGLDRLVMLMTGASSIREVIAFPKTQSAGDVMTQAPGSVDGKALRELHIRLREQPKAE 593
3 -180.0005w25_A mol:protein length:616 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  45  18LRSHAAGLLREGDAGQQVTLAGWVARRRDHGGVIFIDLRDASGIAQVVFRDPQTEVLAQAHRLRAEFCVSVAGVVEIRPEGNANPEIATGEIEVNATSLTVLGECAPLPFQLDEPAGEELRLKYRYLDLRRDDPAAAIRLRSRVNAAARAVLARHDFVEIETPTITRSTPEGARDFLVPARLHPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVDAEDIIAISEEVLTELWALIGYRIPTPIPRIGYAEAMRRFGTDKPDLRFGLELVECTDFFSDTTFRVFQAPYVGAVVM------PGGASQPRRTLDGWQDWAKQRGHRGLAYVLVAE----DGTLGGPVAKNLTEAERTGLADHVGAKPGDCIFFSAGPVKSSRALLGAARVEIANRLGLIDPDAWAFVWVVDPPLFEPAGSGAWTAVHHAFTAPKPEWEDRIESDTGSVLADAYDIVCNGHEIGGGSVRIHRRDIQERVFAVMGLDKAEAEEKFGFLLEAFMFGAPPHGGIAFGWDRTTALLAGMDSIREVIAFPKTGGGVDPLTDAPAPITAQQRKESGIDAQPKRVQQ 609
4 -177.0004rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  47  2LRTHAAGSLRPADAGQTVTLAGWVARRRDHGGVIFIDLRDASGVSQVVFREG--DVLAAAHRLRAEFCVAVTGVVEVRPEGNENPEIPTGQIEVNATELTVLGESAPLPFQLDEQAGEEARLKYRYLDLRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTLTRSTPEGARDFLVPARLQPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVEADDVIAISEQVLKAVWATIGYDLPLPLPRISYEEAMRRFGSDKPDLRFGIELVECTEYFKDTTFRVFQAPY------VGAVVMPGGASQPRRTLDGWQEFAKQRGHKGLAYVLVGE----DGTLGGPVAKNLSDAERDGLVAHVGANPGDCIFFAAGPAKGARALLGATRIEIAKRLDLIDPNAWAFTWVVDFPMFEAVGSGAWTAMHHAFTAPKPDSVDTFDSDPGNALSDAYDIVCNGNEIGGGSIRIHRRDIQERVFAMMGIDHDEAQEKFGFLLDAFSYGAPPHGGIAFGWDRITALLAGVDSIREVIAFPKSGGGVDPLTDAPAPITPQQRKESGIDAKPREDKP 590
5 -177.0004o2d_A mol:protein length:620 Aspartate--tRNA ligase  ali model follow..  47  18LRTHAAGSLRPADAGQTVTLAGWVARRRDHGGVIFIDLRDASGVSQVVFREG--DVLAAAHRLRAEFCVAVTGVVEVRPEGNENPEIPTGQIEVNATELTVLGESAPLPFQLDEQAGEEARLKYRYLDLRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTLTRSTPEGARDFLVPARLQPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVEADDVIAISEQVLKAVWATIGYDLPLPLPRISYEEAMRRFGSDKPDLRFGIELVECTEYFKDTTFRVFQAPY------VGAVVMPGGASQPRRTLDGWQEFAKQRGHKGLAYVLVGE----DGTLGGPVAKNLSDAERDGLVAHVGANPGDCIFFAAGPAKGARALLGATRIEIAKRLDLIDPNAWAFTWVVDFPMFEAVGSGAWTAMHHAFTAPKPDSVDTFDSDPGNALSDAYDIVCNGNEIGGGSIRIHRRDIQERVFAMMGIDHDEAQEKFGFLLDAFSYGAPPHGGIAFGWDRITALLAGVDSIREVIAFPKSGGGVDPLTDAPAPITPQQRKESGIDAKPREDKP 606
6 -168.0004ah6_A mol:protein length:617 ASPARTATE--TRNA LIGASE, MITOCHONDRIAL  ali model follow..  40  11.RTNTCGELRSSHLGQEVTLCGWIQYRRQNT---FLVLRDFDGLVQVIIPQDEASVKKILCEAPVESVVQVSGTVISRPAGQENPKMPTGEIEIKVKTAELLNACKKLPFEIFVKKTEALRLQYRYLDLRSFQMQYNLRLRSQMVMKMREYLCNLGFVDIETPTLFKRTPGGAKEFLVPSR-EPGKFYSLPQSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVDQTGIQSLIEGLLQYSWPNDKDPVVVPFPTMTFAEVLATYGTDKPDTRFGMKIIDISDVFRNTEIGFLQDALSKPHGTVKAICIEGAKYLKRKDIESIRNFAADHFNQEILPVFLNA----NRNWNSPVANFIMESQRLELIRLMETQEEDVVLLTAGEHNKACSLLGKLRLECARGVVLRDPTLFSFLWVVDFPLFKEENPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILATLL---KEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFRGHDLMSNTPDSVPPEELKPYHIRVSKPTDSK 601
7 -165.0001efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model follow..  46  3.RTHYAGSLRETHVGEEVVLEGWVNRRRDLGGLIFLDLRDREGLVQLVAHPAS-PAYATAERVRPEWVVRAKGLVRLRPEP--NPRLATGRVEVELSALEVLAEAKTPPFPVEKEASEELRLKYRYLDLRRRRMQENLRLRHRVIKAIWDFLDREGFVQVETPFLTKSTPEGARDFLVPYRHEPGLFYALPQSPQLFKQMLMVAGLDRYFQIARCFRDEDLRADRQPDFTQLDLEMSFVEVEDVLELNERLMAHVFREALGELPLPFPRLSYEEAMERYGSDKPDLRFGLELKEVGPLFRQSGFRVF-------------QEAESVKALALPKALSRKEVAELEEVAKRHKAQGLAWARVEEGGFSGGVAKFLEPVREALLQATEARPGDTLLFVAGPRKVAATALGAVRLRAADLL-GLKREGFRFLWVVDFPLLEWDEEEAWTYMHHPFTSPHPEDLPLLEKDPGRVRALAYDLVLNGVEVGGGSIRIHDPRLQARVFRLLGIGEEEQREKFGFFLEALEYGAPPHGGIAWGLDRLLALMTGSPSIREVIAFPKNKEGKDPLTGAPSPVPEEQLRELGLMVVRP.... 580
8 -117.0004up7_A mol:protein length:777 LYSINE--TRNA LIGASE  ali model follow..  18  32.VSITVPEFIAQVSDDIVSVAGRVLSKRSSSSLMFIDLHDSQTKLQIMLNKSAYENKEDFVSIYRGDICGFTGHP---------TRTKTGELSLIPISGMILSPCHMLPSMHYGLGDQETRFRKRYLDLINPESVKNFVLRTKVVKAVRKYLDDKGFLEVETPILNIPGGATARPFITHHNQLDIQMY-MRIAPELYLKELVVGGINRVYEIGRLFRNEGIDQTHNPEFTTCEFYMAYADYNDIMKMTEELLGNMVK-----------DITGGSTKLEIKDRLMDINNEEDIKMLEKFFKEPIPRPFNSAECSKVIEKHCTELNYYYDGNNEKAMKKLFADFVTEKKMVLDFTAPFKRISYVHALEEKF--------------------GEKIPRPLDGPEALTFLKKQAIRFNAIC-AEPQTTARVMDKLFGDLIEVDLVQTFVCDQPQLMSPLAKY-----HRSEPELTERFELFILKREIANAYTELNNPIVQRSNFEQQAKGDDEAQLVDEVFLDAIEHAFPPTGGWGLGIDRLAMLLADVDNIKEVILFPTMRPEDELEKKAREAKEDAMVAQELAATEEKGGKK 594
9 -90.1004ex5_A mol:protein length:529 Lysine--tRNA ligase  ali model follow..  22  57.PTHHAADLQTAAKSLEVAIAGRMMLKRVMGKASFATVQDGSGQIQFFVTPADAETYDAFKKWDLGDIVAARGVLFRT---------NKGELSVKCTQLRLLAKARPLPDKFHGLADQETRYRQRYVDLVTPETRTTFRARTKAIASIRKFMGDADFMEVETPMLHPIPGGAAAKPFVTHHNALDMEMFLRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRWLMDFTERLIRQAAVDALGTATIQY---------------------------------------------------------------------------------------------------------QGRELDLAQPFHRLTITQAIQKYAPSYTDGQLSDDAFLRSELKRLGVQPAFLNAGIGALQLALFEETAEAQLWEPTFIIDYPIEVSPLARESDTVAGITERFELFITGREIANGFSELNDPEDQAARFKKQVEGDEEAMFFDADYIRALEYGMPPTGGCGIGIDRLVMLLTDSPTIRDVLLFPHLRRED............................. 523
10 -89.9001e1o_A mol:protein length:504 LYSYL-TRNA SYNTHETASE, HEAT INDUCIBLE  ali model follow..  22  41.RDHTSDQLHEESLNIEVSVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDSLPENDQFKKWDLGDIIGARGTLFKT---------QTGELSIHCTELRLLTKARPLPDKFHGLQDQEVRYRQRYLDLANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVIPGGASARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYHDLIELTESLFRTLAQEVLGTTKVTY---------------------------------------------------------------------------------------------------------GEHVFDFGKPFEKLTMREAIKKYRPETDMADLDNFDAAKALAESIGITVEKSWGLGRIVT-EIFDEVAEAHLIQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAERFQEQVNGDDEAMFYDEDYVTALEYGLPPTAGLGIGIDRMIMLFTNSHTIRDVILFPAMRPQK............................. 504
11 -89.9001bbu_A mol:protein length:504 PROTEIN (LYSYL-TRNA SYNTHETASE)  ali model follow..  22  41.RDHTSDQLHAEALNIEVAVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDDLPENEQFKKWDLGDILGAKGKLFKT---------KTGELSIHCTELRLLTKARPLPDKFHGLQDQEARYRQRYLDLSNDESRNTFKVRSQILSGIRQFMVNRGFMEVETPMMQVIPGGAAARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESLFRTLAQDILGKTEVTY---------------------------------------------------------------------------------------------------------GDVTLDFGKPFEKLTMREAIKKYRPETDMADLDNFDSAKAIAESIGIHVEKSWGLGRIVT-EIFEEVAEAHLIQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAQRFLDQVAGDDEAMFYDEDYVTALEHGLPPTAGLGIGIDRMVMLFTNSHTIRDVILFPAMRPVK............................. 504
12 -89.6005eln_A mol:protein length:535 Lysine--tRNA ligase  ali model follow..  19  42.ISMSLPAYALKYKDTTLSLSGRVTSIRSSSKLIFYDIFCEEQKVQIIANIMEHDISVSHSEIRRGDVVGFTGFPGKS---------KRGELSLFSKSVVLLSPCHMLPTAISGLKDQEVRYRQRYLDLLNEESRKVFKLRSRAIKYIRNYFDRLGFLEVETPMLNMIYGGAAARPFITYHNELETQLYMRIAPELYLKQLIVGGLDKVYEIGKNFRNEGIDLTHNPEFTAMEFYMAYADYYDLMDLTEELISGLVLEIHGSLKIPYHPDGPE--------------------------------------------------------------------------------------------------GKCIEIDFTTPWKRFSFVEEIESGLGEKLKRPLDSQENIDFMVEMCEKIELPHPRTAAKLLDKLAGHFVETKCTNPSFIIDHPQTMSPLAKWHREKPEMTERFELFVLGKELCNAYTELNEPLQQRKFFEQQADGDVEACPIDETFCLALEHGLPPTGGWGLGIDRLIMFLADKNNIKEVILFPAMRNVKQNAQHSNQHSG.................. 528
13 -89.3003a74_A mol:protein length:493 Lysyl-tRNA synthetase  ali model follow..  22  33.RTHKAEELFELEQQIEVAVAGRIMTKRGMGKAGFAHIQDVTGQIQIYVRQDDEQQYELFKISDLGDIVGVRGTMFKT---------KVGELSIKVSSYEFLTKARPLPEKYHGLKDIEQRYRQRYLDLMNPESKKTFITRSLIIQSMRRYLDSHGYLEVETPMMHAVAGGAAARPFITHHNALDMTLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGISTRHNPEFTMLELYEAYADFRDIMKLTENLIAHIATEVLGTTKIQY---------------------------------------------------------------------------------------------------------GEHLVDLTPEWRRLHMVDAIKEYVGVDFWRQMSDEEARELAKEH---VEVAPHMTFGHIVNEFFEQKVEDKLIQPTFIYGHPVEISPLAKKNPDDPRFTDRFELFIVGREHANAFTELNDPIDQRQRFEEQLKGNDEAHEMDEDFLEALEYGMPPTGGLGIGVDRLVMLLTNSPSIRDVLLFPQMRHK.............................. 493
14 -88.7005hgq_A mol:protein length:524 Lysine--tRNA ligase  ali model follow..  18  35.VSISLADFIAKYNDIVQSVAGRVFSKRESGKLIFYDLHGEGTRLQVLANARFHSGDEAFDRIKRGDIIGVNGYPARS---------KSGELSIIPYEIIQLTPCHMLPHTHFGLKNQETRYRMRYLDLMNPDVKNRFVTRSRMISFLRRYLDNLGFLEVETPMMNLIAGGATAKPFITHHNDLDMDLYLRVAPELYLKMLVVGGIDRVYEIGRVFRNEGIDQTHNPEFTSCEFYMAYADYEDLMKITEDMLARMVYYMHGTYKIQYH-------------------------------------------------------------------------------------------------PNGIVENPVYEVDFTPPFRKVNIYDGLQEKLGIQFPPADTLDTDEANKFFDKLAVECPAPRTTARLLDKLIGEFLEPTFISPTFLTGHPQIMSPLAKWHRSIPGLTERFELFVVTKEIVNAYTELNDPLTQRLRFDEQAKGDDEAQNIDENYCTALEYGLPPTAGWGMGIDRLAMILTDSNNIKEVLFFPAMRPDEKGTNVLDEGGNA................. 524
15 -88.2004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  22  61....RVRDLTIQKADEVVWVRARVHTSRAKGKQCFLVLRQQQFNVQALVAVGSKQMVKFAANINKESIVDVEGVVRKVNQKI--GSCTQQDVELHVQKIYVISLAPRLPLQLDDTVNQDTRLDNRVIDLRTSTSQAVFRLQSGICHLFRETLINKGFVEIQTPKIISAASEGGANVFTVSYFKNNAY--LAQSPQLYKQMCICADFEKVFSIGPVFRAEDSNTHRHTEFVGLDIEMAFNYYHEVMEEIADTMVQIFKGLQERFQTEIQTVNKQFPCEPFKFLEPTLRLEYC----------------------------------------------------------------------------------------------------------------------ALAMLREAGVEMGDEDDLSTPNEKLLGHLVKEKYDTDFYILDKYPLAVRPYTMPDPRNPKQSNSYDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEK----IKAYIDSFRFGAPPHAGGGIGLERVTMLFLGLHNVRQTSMFPRDPKRLTP........................... 515
16 -88.0003bju_A mol:protein length:521 Lysyl-tRNA synthetase  ali model follow..  18  33.VDISLTDFIQKYTDITLKVAGRIHAKRASGKLIFYDLRGEGVKLQVMANSRNYKSEEEFNKLRRGDIIGVQGNPGKT---------KKGELSIIPYEITLLSPCHMLPHLHFGLKDKETRYRQRYLDLLNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPE--------------------------------------------------------------------------------------------------GQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEEDDICVAKAVECPPPRTTARLLD-KLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPEDK............................ 510
17 -86.5006chd_A mol:protein length:597 Lysine--tRNA ligase  ali model follow..  18  101.VDISLTDFIQKYTDITLKVAGRIHAKRASGKLIFYDLRGEGVKLQVMANSREEEFIHINNKLRRGDIIGVQGNPGKT---------KKGELSIIPYEITLLSPCHMLPHLHFGLKDKETRYRQRYLDLLNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPE--------------------------------------------------------------------------------------------------GQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEEDDICVAKAVECPPPRTTARLLD-KLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPEDKKENVATTDTLESTTVGTSV......... 597
18 -86.5006aqh_A mol:protein length:508 Lysine--tRNA ligase  ali model follow..  21  41.RTHTLLEIRQARTGEIVGVTGRVVFARNSGKLCFATLQEGDGQLQAMISLAEVGQEAWKTYVDIGDIVFVHGEVITS---------KRGELSVLADSWQMAAKARPLPVAHKEM-SEESRVRQRYVDLVRDQARKVARQRIAVMRAIRSALERRGFLEVETPMLQTLAGGAAARPFVTHSNALDTELYLRIAPELFLKRCLVGGFERVFELNRVFRNEGADSTHSPEFVMLETYQAYGTYDDSAVVTRELIQEVADEAIGTRQVPL--------------------------------------------------------------------------------------------------------PDGTVYDLDGEWESIQMYPSLSEALGEEITPDTPAETLWAIADRLGLDIPRDRGYGHGKLVEELWEHTVGAKLWAPTFVKDFPVETTPLTRSHRSIPGVTEKWDLYVRRIELATGYSELTDPIIQRERFEAQARGDDEAMALDEDFLAALEYGMPPSTGTGMGIDRLMMTLTGL-SIRETVLFPIVKP............................... 501
19 -85.9005vl1_A mol:protein length:506 Lysine--tRNA ligase  ali model follow..  23  38.RTHTLAEIRASATEDIVGVAGRVVFARNTGKLCFATLQDGDGQLQAMISLDEVGRESWKADVDIGDVVYVHGTVISS---------RRGELSVLADSWRMAAKARPLPVAHKEM-SEESRVRQRYVDLVRPQAREVARQRIAVIRAVRNALERRGFLEVETPMLQTLAGGAAARPFVTHSNALDIDLYLRIAPELFLKRCIVGGFDRVFELNRVFRNEGSDSTHSPEFSMLETYQTYGTYDDSALITRELIQEVADEAIGTRQLSMP--------------------------------------------------------------------------------------------------------DGSVYDIDGEWATMEMYSSLSEALGEQITPETTVARLRDIASGLDVEIDNSVFGHGKLVE-ELWEHAVGNKLTAPTFVKDFPVETTPLTRQHRSIPGVTEKWDLYVRGVELATGYSELNDPVVQRDRFADQARGDDEAMQLDEDFLTALEYGMPPCTGTGMGIDRLLMCLTGL-SIRETVLFPIVRPHSN............................ 500
20 -85.8001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  28  3.RTHYSSEITEELNGQKVKVAGWVWEVKDLGGIKFLWIRDRDGIVQITAPKKDPELFKLIPKLRSEDVVAVEGVVNFTPKAKLG-------FEILPEKIVVLNRATPLPLDPTGKVELDTRLNNRFMDLRRPEVMAIFKIRSSVFKAVRDFFHENGFIEIHTPKIIATATEGGTELFPMKYFEEDAF--LAESPQLYKEIMMASGLDRVYEIAPIFRAEEHNTTRHNEAWSIDSEMAFIDEEEVMSFLERLVAHAINYVREHPKLPFPRVSYDKALEILGDLGKEIPWGEDIDT---------------------------------------------------------------------------------------------------------------------------------------EGERLLGKYMMENENAPLYFLYQYPSEAKPFYIMKYDKPEICRAFDLEYRGVEISSGGQREHRHDILVEQIKEKGLNPES----FEFYLKAFRYGMPPHGGFGLGAERLIKQMLDLPNIREVILFPRDRRRLTP........................... 438
21 -85.6004ycv_A mol:protein length:516 Lysine--tRNA ligase  ali model follow..  18  33.RTISIPEFIEKYEDTILNITGRIMRVSASGKLRFFDLVGDGEKIQVLANYSFHNFAECYDKIRRGDIVGIVGFPGKS---------KKGELSIFPKETILLSACHMLPMKY-GLKDTEIRYRQRYLDLINESSRHTFVTRTKIINFLRNFLNERGFFEVETPMMNLIAGGANARPFITHHNDLDLDLYLRIATELPLKMLIVGGIDKVYEIGKVFRNEGIDNTHNPEFTSCEFYWAYADYNDLIKWSEDFFSQLVYHLFGTYKISYNKDGPE--------------------------------------------------------------------------------------------------NQPIEIDFTPPYPKVSIVEEIEKVTNTILEQPFDSNETIEKMINIIKEIELPNPPTAAKLLDQLASHFIENKYNKPFFIVEHPQIMSPLAKYHRTKPGLTERLEMFICGKEVLNAYTELNDPFKQKECFKLQQKGDTEAAQLDSAFCTSLEYGLPPTGGLGLGIDRITMFLTNKNSIKDVILFPTMRPAN............................. 508
22 -83.9001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  26  3.RSHFIADVTPEYDGKEVIWAGWVHLLRDLGGKKFIILRDKTGLGQVVVDKNS-SAFGISQELTQESVIQVRGIVKADKRA-------PRGIELHAEEITLLSKAAPLPLDVSGKVKADTRLRERVLDLRRQEMQAVIKIQSLALKAFRETLYKEGFIEIFTPKIIASATEGGAQLF--PVIYFGKEAFLAQSPQLYKE-LMAGVVERVFEVAPAWRAEESDTPFHAEFISMDVEMAFADYNDVMQLLEKILHNIVKTIKEEVKIPIKRLKYTEAIEILRSKGYNIKFGDDIGT-------------------------------------------------------------------------------------------------------------------------------------------PELRILNEELKEDLYFIVDWPSDARPFYTKSKSNPELSESFDLIYKFLEIVSGSTRNHKREVLEEALKKKGLKPES----FEFFLKWFDYGMPPHAGFGMGLARLMVMLTGIQSVKEIVPFPRDKKRLTP........................... 429
23 -83.0003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  22  14VETPIVCNIRDGLEGKLVTFKGWAYHIRKARKLIFVELRDGSGYCQCVIFGKELCEPEKVKLLTRECSLEITGRLNAYAGKNHPPEIADLNLEMQVTEWKVIGESIDLENIINKDSSIPQKMQNRHIVIRSEHTQQVLQLRSEIQWYFRKYYHDNHFTEIQPPTIVKTQCEGGSTLFKLQYFNEPAY--LTQSSQLYLE-SVIASLGKSFCMLSSYRAEQSRTVRHAEYLHLEAELPFISFEDLLNHLEDLVCTVIDNVMAVPTRPFKRMTYADAIK---------------------------------------------------------------------------------------------------------------------------------------YCNDHGILNKDKPFEYGEDISEKPERQMTDEIGCPIFMIHFPSKMKAFYMSKVPHPDLTESVDLLMPGVEIVGGSMRIWNYDELMGAYKANGLNPDP----YYWYTQQRKYGSCPHGGYGLGVERLVMWLLGEDHIRKVCLYPRYLERCEP........................... 456
24 -83.0001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  20  26.RVKFVDLDEAKDSDKEVLFRARVHNTRQQGALAFLTLRQQASLIQGLVKANSKNMVKWAGSLNLESIVLVRGIVKKVDEPIKSAT--VQNLEIHITKIYTISETEALPILLEDVVNLDTRLDYRVIDLRTVTNQAIFRIQAGVCELFREYLATKKFTEVHTPKLLGAPSEGGSSVFEVTYF--KGKAYLAQSPQFNKQQLIVADFERVYEIGPVFRAENSNTHRHTEFTGLDMEMAFEEYHEVLDTLSELFVFIFSELPKRFAHEIELVRKQYPVEEFKLPKDGKMVRLTYKEGIEMLRAAGKEIGDFEDLSTENEKF-------------------------------------------------------------------------------------------------------------------LGKLVRDKYDTDFYILDKFPLEIRPYTMPDPANPKYSNSYDFFMRGEEILSGAQRIHDHALLQERMKA--HGLSPEDPGLKDYCDGFSYGCPPHAGGGIGLERVVMFYLDLKNIRRASLFPRDPKRLRP........................... 490
25 -79.1005xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  21  39..........EGYRGQRVKVFGWVHRLRRQGKLMFLVLRDGTGYLQCVLADELCQC-YNGVLLSTESSVAVYGMLNLTPKG----KQAPGGHELSCDFWELIGLAAGGADNLIEESDVDVQLNNRHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAF--LTQSSQLYLE-TCLPALGDVFCIAQSYRAEQSRTRRHAEYTHVEAECPFLTFDDLLNRLEDLVCDVVDRILKSPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDI---------------------------------------------------------------------------------------------------------------------------------------EAPERLMTDTINEPILLCRFPVEIKSYMQRCPEDSRLTESVDVLMNVGEIVGGSMRIFDSEEILAGYKREGIDPTP----YYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYPRFVQRCTP........................... 466
26 -79.1003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  18  48LKYTEIEELVPAMAEKTVTIRARVQAVRGKGNMVFLFLRKGIYTCQALVMKSSKEFVQFCQKISAESICDITGIVKAVEKPI--EKATQQDVEIHVTSIAVVSLAEKASAQKYVKVSQDTRLDNRMLDLRTVTNIAIFRIQSACCGLFREFLTSQKFVEIHTPKLIGCSSEGGSNIFEVKYFDRKAY--LAQSPQLYKQMAIMGDFRKVFEVGPVFRAENSNTRRHTEFEGLDIEMEIVNYHECIDVMEKLFTFIFDEIPKRIYRPFLRLTYKEAIE---------------------------------------------------------------------------------------------------------------------------------------MLRASGETIGDYDDFTTPQEVKLGELIKAKYNTDFYILDKFPAAIRPFTMPDIDDPNYSNSYDVFVRGQEITSGAQRIHDPEFLMKRCIEKGVDPAT----LKDYIESFRFGSWPHAGCGIGLERITMLYLGIPNIRKVTLFPRDPIRLNP........................... 548
27 -79.0001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  24  2IEKVYCQEVKPELDGKKVRLAGWVYTNMRVGKKIFLWIRDSTGIVQAVVAKNGEETFEKAKKLGRESSVIVEGIVKADER-------APGGAEVHVEKLEVIQAVSEFPIPEPEQASPELLLDYRHLHIRTPKASAIMKVKETLIMAAREWLLKDGWHEVFPPILVTGAVEGGATLF--KLKYFDKYAYLSQSAQLYLEAA-IFGLEKVWSLTPSFRAEKSRTRRHTEFWHLELEAAWMDLWDIMKVEEELVSYMVQRTLELTEPPFPRISYDEAIDILQSKGVNVEWGDDLGA--------------------------------------------------------------------------------------------------------------------------------------------DEERVLTEEFDRPFFVYGYPKHIKAFYMKEDPDPRKVLASDMLAGYGEIIGGSQREDDYDKLLNRILEEGMDPKD----YEWYLDLRRYGSVPHSGFGLGVERLVAWVLKLDHIRWAALFPRTPARLYP........................... 434
28 -77.4002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  23  9..........VKHRNERVCIKGWIHRMRRQGKLMFFILRDGTGFLQVLLMDKLCQT-YDALTVNTECTVEIYGAIKEVPEG----KEAPNGHELIADFWKIIGNAPPIDNVLNEEASVDKMLDNRHLVIRGENAAALLRLRAAATRAMREHFYNAGYVEVAPPTLVQTQVEGGSTLFNLDYFGEQSF--LTQSSQLYLETC-IPTLGDVFCIAQSYRAEKSRTRRHAEYAHVEAECPFITLDDLMEKIEELVCDTVDRLLADPERPFLRMEYKDAIKWLQEHNVENEFGNTFTYGEDI---------------------------------------------------------------------------------------------------------------------------------------EAAERFMTDTINKPILLNRFPSEIKAFMQRDAKDNTLTESVDLLMPGVEIVGGSMRIWKFDELSKAFKNVEIDPKP----YYWYLDQRLYGTCPHGGYGLGLERFICWLTNTNHIRDVCLYPRFVGRCVP........................... 437
29 -76.8001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  28  1MRVLVRD---KAHVGQEVELLGFLHWRRDLGRIQFLLLRDRSGVVQVVTGGL--------KLPLPESALRVRGLVVENAK-------APGGLEVQAKEVEVLSPAEPTPVEIEWRANPDTLLEYRYVTLRGEKARAPLKVQAALVRGFRRYLDRQDFTEIFTPKVVRAGAEGGSGLFGVDYFEKRAY--LAQSPQLYKQ-IMVGVFERVYEVAPVWRMEEHHTSRHNEYLSLDVEMGFIDEEDLMRLEEALLAEMLEEALNTFPQDIPRLTHAEAKRILKEELGYPVGQDLSEEAERL----------------------------------------------------------------------------------------------------------------------------------------LGEYAKERWGSDWLFVTRYPRSVRPFYTYPE-EDGTTRSFDLLFRGLEITSGGQRIHRYEELLESLKAKGMDPEA----FHGYLEVFKYGMPPHGGFAIGAERLTQKLLGLPNVRYARAFPRDRHRLTP........................... 422
30 -65.9003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  20  2.................................................................................................................GSSSSGLVPRGSHMSEQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIETRFVGPGHSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDC------PAAESLSYQQAFLRYLEIDP---------------------------------------------------------------------------------------------------------------------LSADKTQLREVAAKLDLSNVADTEEDRDTLLQLLFTFGVEPNIEKPTFVYHFPASQASLAQISTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDNRRGLPQHPIDQNLIEALKVGMPDCSGVALGVDRLVMLALGAETLAEVIAFSVDRA............................... 339
31 -62.4003g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  22  9.................................................................................................................................QPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIETRFVGPGHSQGINLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDC------QPAESLSYQQAFQRHLEIDP---------------------------------------------------------------------------------------------------------------------LSADKTQLREAAAKLDLSNIADTEEDRDTLLQLLFTMGVEPHIEKPTFIYHFPASQASLAQISTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDNRRGLPQQPIDQNLLDALAAGLPDCSGVALGVDRLVMLALGAESLADVIAFTVDRA............................... 326
32 -58.8003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein  ali model follow..  20  2............................................................................................................................NAVEIISRDIYKAIDIQTKILDYMTKFFTDRGFKWLLPIMLSPITPDPAGEGIRPAEVD-GVRMRLTHSMILHKQLAIAMGLEKIFVLSPNIRLESRRKDHSYEFTQLDFEIEGAKMKDVMRLIEELIYGLFRKAEEPRARHFKVYDYKDILEEFGSDE-----------------------------------------------------------------------------------------------------------------------------------------------------------KASMEMEEPFWIVNIPREFYD---REENGVWKNYDLILPYGYGEVSSGGEREWEYEKIVAKIRAAGLKEDS----FRPYLEIARAGLKPSAGAGIGVERLVRFIVGAKHIAEVQPFPRVPGIPAVI.......................... 294
33 -55.4001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  21  2............................................................................................................................NAVEIISREISPTLDIQTKILEYMTDFFVKEGFKWLLPVIISPITPDPAGEGMEPAEVE-GVKMRLTHSMILHKQLAIAMGLKKIFVLSPNIRLESRQKDHAYEFTQLDFEVERAKMEDIMRLIERLVYGLFRKAEEPKTKRFEVFEYSEVLEEFGSDEK-----------------------------------------------------------------------------------------------------------------------------------------------------------ASQEMEEPFWIINIPREFYDREVDGFW---RNYDLILPYGYGEVASGGEREWEYEKIVAKIRKAGLNEDS----FRPYLEIAKAGLKPSAGAGIGVERLVRFIVGAKHIAEVQPFPRIPGIPAVI.......................... 294
34 -44.8005gro_A mol:protein length:115 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  38  6MRSHFCTEISEKDVGKIVKVAGWCNTYRDHGGVVFIDLRDKSGLVQLVCDPSS-KAYEKALEVRSEFVLVAKGKVRLRGAGLENPKLKTGKIEIVLEELIIENKS..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 109
35 -42.5004lns_A mol:protein length:351 Asparagine synthetase a  ali model follow..  10  4...........................................................................................................................DGYSSYVL-LQEQILTVKRSFSEALEKEL---NLVEVRAPILFRVGDGTQDNLSVPVKAIPNASFEVVHSLAKWKRRTLFAPGHGLYTHMTALRDDVLDNIHSVVVDQWDWEMVMKDDQRNLAFLKEVVCKVYAAIRKTELAVCEKYKQKPIL-------PETIQFVHAEHLLLAYPNLTAKEREREIAREYGAVFLIGIGAVLSSGDRHDARAPDY---------------------------------------------------------------------------------------------------DDWTSPVEASQVVFPRTSKPIPTMNSLSSLKGLNGDILLDSLEVSSMGIRVNAEALRHQ----ISLTGDDSLLKSEWHQQLLNGEFPQTVGGGIGQSRMVMFMLRKKHIGEVQCWPEEIRKKHNLL......................... 351
36 -41.80011as_A mol:protein length:330 ASPARAGINE SYNTHETASE  ali model follow..  14  1.....................................................................................................................................MKTAYIAKQRQISFVKSHFSRQGLIEVQAPILSRVGDGTQDNLSVKVKALPDAQFEVVHSLAKWKRQTLFSAGEGLYTHMKALRDEDRLSPLH-YVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATLPDQIHFVHSQELLSRYPDLDAK--------------------------------------------------------------------------------------------------------------------------------GRERAIAKDLGAVFLVGIGGKLSDGHRHDVRAPDYDDWSTPSELGHAGLNGD----ILVWNPVLEDAFELSSMGIRVDADTLKHQLALT----GDEDRLELEWHQALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQAWPAAVRESVP........................... 327
37 -41.5004gn5_A mol:protein length:113 OBody AM3L15  ali model follow..  26  5.KTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERDHLFKVFAELSREDVVVIKGIVEAGWPVAL-----DTGVEIFPSEIWILNKAKPLPID............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 113
38 -38.9004gn3_B mol:protein length:113 OBody AM1L10  ali model follow..  26  9.KTHWTAEITPNLHGTEVVVAGWVASLGDYGRVKIVKVSDREGGAAVSVYLEYDHLFKVFAELSREDVVVIKGIVEASKA---AADMHNG-VEIFPSEIWILNKAK.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 113
39 -38.8004gla_C mol:protein length:109 OBody NL8  ali model follow..  24  7.KTHWTAEITPNLHGTEVVVAGWVASLGDYGRVKIVKVSDREGGAAVPVYLEADHLFKVFAELSREDVVVIKGIVEASK-------GVGRGVEIFPSEIWILNKAKA................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 109
40 -38.7004gn4_B mol:protein length:108 OBody AM2EP06  ali model follow..  25  6.KTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERDHLFKVFAELSREDVVVIKGIVEASEQYGS-----ATGVEIFPSEIWILNKA..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 108
41 -38.3004glv_B mol:protein length:107 OBody AM3L09  ali model follow..  25  5.KTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERDHLFKVFAELSREDVVVIKGIVEATTVTRW-----DTGVEIFPSEIWILNKA..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 107
42 -35.8002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  13  3........................................................SSSSGLVPRGSHMFLTRRDPPLSSFTKVQYQRLKELNASGEQLEMGFSDLSRDRAFQGIEHQLMSQGKRHLELRTVKHRPAL---LELEEKLAKALHQQGFVQVVTPTILAKMTIGEDHPLFSQVFWLDGKKCLRLAPNLYTLWRLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAA........................................................................................................................................................................................................................................................................................................................................... 216
43 -25.6004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  15  3........................................................SSSSGLVPRGSHMASAPALTKS---------QTDRLEVLLNPKDEISLNS--GKPFRELESELLSRRKKDLQQIYAE--ERENYLGKLEREITRFFVDRGFLEIKSPILIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLGNYLLPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCENLESIITDFLNHL............................................................................................................................................................................................................................................................................................................................................... 201
44 -25.3002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  15  7............................................................GLVPRGSHMASAPALTKS---------QTDRLEVLLNPKDEISLN--SGKPFRELESELLSRRKKDLQQIYAE--ERENYLGKLEREITRFFVDRGFLEIKSPILIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLLPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCENLESIITDFLNHL............................................................................................................................................................................................................................................................................................................................................... 201
45 -24.1004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  16  7............................................................GLVPRGSHMASAPALTKS---------QTDRLEVLLNPKDEISLN--SGKPFRELESELLSRRKKDLQQIYAE--ERENYLGKLEREITRFFVDRGFLEIKSPILIERMGIDNDTELSKQIFRVDKNFCLRLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLSFIQMGSGRENLESIITDFLNHL............................................................................................................................................................................................................................................................................................................................................... 201
46 -20.6003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  20  3.......................................................................GGLVPRGSHGASAPALQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKK----DLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIERMGIDNDTELSKQIFRVDKNFCLRLTPNLYNYLRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLVFWQMGSGRENLESIITDFLNHL............................................................................................................................................................................................................................................................................................................................................... 198
47 -20.4005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  16  2...............................................................................PALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYA------EERENYLGKLEREITRFFVDRGFLEIKSPILIERMGIDNDTELSKQIFRVDKNFCLRLAPNLYNYLRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLAFAQM-CTRENLESIITDFLNHL............................................................................................................................................................................................................................................................................................................................................... 184
48 -19.8004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  16  1..............................................................................PALTKSQTDRLEVLLNPKDEISL---------SGKPFRELESELLSRRKKLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIERMGIDNDTELSKQIFRVDKNFCLRVAPNIFNYARKLDR--KIFEIGPCYRKESDGKEHLEEFTMLNFFQM-CTRENLESIITDFLNHL............................................................................................................................................................................................................................................................................................................................................... 183
49 -18.6004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  20  3............................................................................................ALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKK-EERENYLGKLEREITRFFVDRGFLEIKSPILIERMGIDNDTELSKQIFRVDKNFCLRLAPNLANYLRKLD---KIFEIGPCYRKESDGKEHLEEFTMLNFCQSGCTRENLESIITDFLNHL............................................................................................................................................................................................................................................................................................................................................... 184
50 -12.4003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  13  1.....................................................................................................MAMGTLEAQTQGPGSMQMNMVETEPVQGCRDFPPETMRLRKYLFDVFHSTARKFGFEEYDSPLYIRKAGEEITEQMFNFITKGGHRVALPEMTPSLARQLLAKGRSKWYSIPQCWRYEAITRGRRREHYQWNMDISVSSEVELVCAACTAMQSLGLSSKDVGVKINSRKILQTVVEQAGVSADKFAPVCVIVDKMEKLPREEV-----------------------------------------------------------VAQLAAIGLESNVVDAITSTLSLKTIDEIAQRIGEEHEAVRELRDFITQI-EAYGFGDWVIFDASVVRGLAYYTGIV---------------------------------FEGFDRDGNFGGG--------------------------RYDNLLTTYGSPTAPCVGFGFGDCVIVELLNEKKLLPDDLVIPFDETMRPHALSILRRLRDAGRS............. 384
51 -12.2005ucm_A mol:protein length:579 Proline--tRNA ligase  ali model follow..  12  1..........................................................................MAMRTSQYLLSTLKETPADAVVISHQLLLRAGMIRRLASGL--------YTWLPM-------GLRVLRKVETIVREEMNAAGALEVLMPAVQPAE-EQYGPELLRLKDRHEREFCVGPTHEEVITDLARNELNSYYQIQTKFRDE-----RGREFIMKDAYSFHLSQDSLQQTYDGM-YQAYSKIFSRLGLDFRPVQ-ADNGSIGGSGSHEFHVLANSGE--------DDIVFSDSSDYAANIEKAEAVPRESARGSATEDMRLVDTPNTKTIAALVDGFQLPIEKTIKTLVVHGAEEGTLVALIVRGDHELNEIKAANQPLVASPLVFASEAEIRAAIGAGPGSLGPVNLPIACIVDRSV-IEDKHYFGVNWERDLPLPEVADLRNVVEGDPSPDGKGTLVIKRGIEVG-------------HIFQ---LGTKYSEAMKLSVLSEQGKPVNLIMGYGIGVSRVVAAAIEQNHDERGILWPSALAPFQIALVPLKYETESELTAAGFEVLLDDRDK 513
52 -12.1002j3l_A mol:protein length:572 PROLYL-TRNA SYNTHETASE  ali model follow..  12  1............................................................................MKQSKMLIPTLREVPNDAEVLSHQILLRAGYIRQVAAGI--------YSYLPL-------ANRVLEKLKTIMREEFEKIDAVEMLMPALLPAE-ETYGPNLYRLKDRNDRDYILGPTHEETFTELIRDEINSYYQIQTKYRDE-----RGREFIMKDGYSFHADEASLDQSYRDY-EKAYSRIFERCGLEFRAIIGDGGAMGGKDSKEFMAISEIGEDTICYSTESDYAANLEMATSLYTPKKSHETQLDLEKIATPEVGTIAEVANFFEVEPQRIIKSVLFIADEEPVMVLVRGDHDVNDVKLKNFLGADFLDEATEEDARRVLGAGFGSIGPVNVSEDVKIYADLAVQDLANAIVGANEDGYHLTNVNPDRDFQPISYEDLRFVQEGDPSPDGNGVLAFTKGIEIG-------------HIFK---LGTRYSDAMGATVLDENGREKSVIMGYGIGVSRLLSAIVEQNADERGINWPTG---------APFDLH-AMMTEAGYEVLVDDRNE 510
53 -11.9001nnx_A mol:protein length:109 Protein ygiW  ali model follow..  18  24.SVTTVESAKSLRDDTWVTLRGNIVERISDDLYVF---KDASGTINVDIDHKRWNG----VTVTPKDTVEIQGEV----------DKDWNSVEIDVKQIRKVNP...................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 109
54 -11.3003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  13  1................................................................................................................SNAMAKNDKINFSTPSGFPEFLPSEKRLELYLLDTIRRVYESYGFTPIETPALEPILPPNRQAEKDKSGDTGSEARALFDQTVPLAAYIARHLNDARYQMDVVFRGERAKDGRFRQFRQCDIDV------------------------------------------VGREKLSLLYDAQMPAITEIFEAVNIGDFVIRINNRKVLTGFFQSLNISETQIKSCISIIDNLEKIGEAKV-----------------------KLELEKEGINPEQTQKIIDFVKIDGSVDDVLDKLKHLSQTLPESEQFNLGVSE--------TVITGVRNLGVPDKRFCIDL-----------------------IARGLNYYTGT-----------VYETTLIGHEALGSRYEELVGTFIGEKMPGVGISIGLTRLISRLLKAGILNQVVVVNMQDELMPTYLKVSQQLRQAGLN............. 400
55 -11.0003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  14  1.....................................................................................................MAMGTLEAQTQGPGSMQKNMVETEPVQGCRDFPPEAMRCRRHLFDVFHATAKTFGFEEYDAPLYIRKAGEEITEQMFNFITKGGHRVALPEMTPSLARLLLGKGRSKWYSIPQCWRYEAITRGRRREHYQWNMDISVSAEVELVCAACWAMRSLGLSSKDVGIKVNSRKVLQTVVEQAGVTSDKFAPVCVIVDKMEKIPREEVE-----------------------------------------------------------AQLAVLGLEPTVVDAITTTLSLKSIDEIAQRVGEEHEAVKELRQFFEQV-EAYGYGDWVLFDASVVRGLAYYTGIV---------------------------------FEGFDREGKFGGG--------------------------RYDNLLTTYGSPTPPCAGFGFGDCVIVELLQEKPHVVDDVVIPFDESMRPHALAVLRRLRDAGRS............. 384
56 -11.0004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  12  17.....................................................................ALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDY----SPRQMAVREKVFDVIIRCFKRHGAEVIDTPVTLMGKYGEDSKLIYDLKDQGGELLSLYDLTVPFARYLAMNKLTKRYHIAKVYRRDAMTRGRYREFYQCDFDI------------------------------------------AGNFDPMIPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDDKISFDLSLARGLDYYTGVIYEAVLLQT------------AQAGEEPLGVGSVAAGGRYDGLVG--MFDPKGRKV------------------------------------PCVGLSIGVERIFSIVEQDAGIKAELLYKKNPKLLNQLQYCEEAIGEQELKDGVIKLRSVTSRE 496
57 -10.5004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  12  4.................................................................................................................SEFELRRQFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFLMGKYGEDSKLIYDLKDQGGELLSLYDLTVPFARYLAMNKLTKRYHIAKVYRRDAMTRGRYREFYQCDFDI------------------------------------------AGNFDPMIPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDDKISFDLSLARGLDYYTGVIYEAVLLQT------------AQAGEEPLGVGSVAAGGRYDGLVG--MFDPKGRKV------------------------------------PCVGLSIGVERIFSIVEQDAGIKAELLYKKNPKLLNQLQYCEEAIGEQELKDGVIKLRSVTSRE 443
58 -10.4003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  12  1........................................................................................................SNAMNGTRSAWGARAWEAVRGFADRMQDGYPDFAKRRRAVETRLLSFVEDAGYEPVTSGTLLRARSPESSRDWIRLFDGGGDAVALRPEMTPSIARMAAPRVARWCYCERVYRRTDDPASLSWESTQVGIER------------------------------------------IGEEASVDVDMDVLRLLHEASAAAGVRHHRIVVSHARLVPRLLDALGISASLSRAFLACLTSGNYVQFRELWQLHAAKDVDLLANLLTWSPAERDAAKRSREASDRELEALLRDAVDPRAAADVRDAWRYLCR-----------------------LAEALHDSGLASDVVTFDLALHRELDYYT-------GLVFEMFAPGVPIAQGG-------------------------RYDELLAQFGAGAPA--GFAFEVERVMAVLEAQEEGEG........................................ 371
59 -9.9803kf6_A mol:protein length:159 Protein stn1  ali model follow..  14  48...............RWIQIVGYIAAIDIYEGKHVLTVDDCSGMVLRVVIQDDFSMSKRAISMSPGNVVCVFGKINS-----------RSEVELIAQSFEELRDPNDEWKAWQ----KRMRYKKNLTKISKN.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 152
60 -9.7501wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  14  3........................................................................................................................RLQIEKIRGFRDFYPEDMDVEKFIFKTAEEAAEAFGFRRIDFPSLRIKSGEELLQQTYSFVDKGGREVTLPEATPSTVRMVTSRKD-RWYSFPKVWRYEEPQAGRYREHYQFNADISPEADAEVIALASSILDRL-------------------------------------LQDIYEIRINSRKIMEEIIGGMTSSDPFSVFSIIDRYHKISREEFVDQLRSAGIGEDGVSMIADLCSGTRGIDEMAR----------------------ITGKSSEEIARMAAVEDLLASYGVKNVRYDFSIVRGLSYYTGIVFEAYDRSGQFRA-----------------------------------LGGG--------------------------RYDNLASLMSGESVPAVGFGMGDAVISLLLKRPREKKSVYICRVGKINSSIMNEYSRKLRERGMN............. 361
61 -9.2904e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  12  1..................................................................................................MAMGTLEAQTQGPGSMTEQKRKLEKLTGVKGMNDILPQDAGLWEFFEATVKSLLRAYGYQNIRTPIVEHTP--GEVTDIVEKEMYSGENLTLPENTAAVVRAAIEHNMLRLWYIGPMFRHERPQRGRYRQFHQVGVEAGPDADAEIVMMCQRLWEDL---------------------------------------------------------------------------------------------------------------------------------GLTGIKLEINSLGLAEERAAHRVELIKYLEQHADKLDDDAQRRLYTNPLRVLDTKNPA---------LQEIVRNAPKLIDFLGDVSRAHFEGLQRLLKANNVPFTINPRLVRLTVFEWVTDKLGAQGTRYDPLIEQLGGKPTAACGWAMGIERILELLKEEHLVPDVYVVHQGDAAREQAFIVAERLRDTGLD............. 377
62 -9.2404rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  14  2........................................................................................................................PMTARAVRGTKDLFGKELRMHQRIVATARKVLEAAGALELVTPIFEETATDIVRKEMFTFQDRGGRSLTLPEGTAAMVRAYLEHGMKRLWMAGPMFRAERPQKGRYRQFHQVNYEANPILDAEAVVLLYECLKEL---------------------------------------------------------------------------------------------------------------------------------GLRRLKVKLSSVGDPEDRARYNAYLREVLSPHREALSEDSKERLELNPMRILDSKSE-RDQALLKELGVRPMLDFLGEEA------RAHLKEVERHLERLSVPYELEPALVRRTAFEVHHEEIGAQSARYDGLSELLGGPRVPGVGFAFGVERVALALEAEEKGPDLYLIPLTEEAVAEAFYLAEALRPRLRAEYALAPRKPAKG. 371

FFAS is supported by the NIH grant R01-GM087218-01
1 2 6 4 6 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rodrigues AP, Grant BJ, Godzik A, Friedberg I. The 2006 automated function prediction meeting. BMC Bioinformatics. 2007 May 22;8 Suppl 4:S1-4.