current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 1g5h_A mol:protein length:454 MITOCHONDRIAL DNA POLYMERASE ACCESSORY SUBUNIT, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .
# Score Template Links and tools%idFirst WLSGYAGPADGTQQPDAPEHAVAREALVDLCRRRHFLSGTPQQLSTAALLSGCHARFGPLGVELRKNLASQWWSSMVVFREQVFAVDSLHQEPGSSQPRDSAFRLVSPESIREILQDREPSKEQLVAFLENLLKTSGKLRATLLHGALEHYVNCLDLVNRKLPFGLAQIGVCFHPVSNSNQTPSSVTRVGEKTEASLVWFTPTRTSSQWLDFWLRHRLLWWRKFAMSPSNFSSADCQDELGRKGSKLYYSFPWGKEPIETLWNLGDQELLHTYPGNVSTIQGRDGRKNVVPCVLSVSGDVDLGTLAYLYDSFQLAENSFARKKSLQRKVLKLHPCLAPIKVALDVGKGPTVELRQVCQGLLNELLENGISVWPGYSETVHSSLEQLHSKYDEMSVLFSVLVTETTLENGLIQLRSRDTTMKEMMHISKLRDFLVKYLASASNVAAALDLast
1 -147.0001g5h_A mol:protein length:454 MITOCHONDRIAL DNA POLYMERASE ACCESSORY SUBUNIT  ali model  100  1WLSGYAGPADGTQQPDAPEHAVAREALVDLCRRRHFLSGTPQQLSTAALLSGCHARFGPLGVELRKNLASQWWSSMVVFREQVFAVDSLHQEPGSSQPRDSAFRLVSPESIREILQDREPSKEQLVAFLENLLKTSGKLRATLLHGALEHYVNCLDLVNRKLPFGLAQIGVCFHPVSNSNQTPSSVTRVGEKTEASLVWFTPTRTSSQWLDFWLRHRLLWWRKFAMSPSNFSSADCQDELGRKGSKLYYSFPWGKEPIETLWNLGDQELLHTYPGNVSTIQGRDGRKNVVPCVLSVSGDVDLGTLAYLYDSFQLAENSFARKKSLQRKVLKLHPCLAPIKVALDVGKGPTVELRQVCQGLLNELLENGISVWPGYSETVHSSLEQLHSKYDEMSVLFSVLVTETTLENGLIQLRSRDTTMKEMMHISKLRDFLVKYLASASNVAAALD 448
2 -136.0004ztu_B mol:protein length:472 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  77  20.VKSHAELEGNGEHPEAPGSGEGSEALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGPLLPGDSAFRLVSAETLREILQDKELSKEQLVAFLENVLKTSGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKQIRNGVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENSFTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNVAAALE 466
3 -135.0005c51_B mol:protein length:485 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  77  44.VKSHAELEGNGEHPEAPGSGEGSEALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGPLLPGDSAFRLVSAETLREILQDKELSKEQLVAFLENVLKTSGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKQIRNGVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENSFTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV..... 485
4 -134.0002g4c_A mol:protein length:474 DNA polymerase gamma subunit 2  ali model follow..  77  27.VKSHAELEGNGEHPEAPGSGEGSEALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGPLLPGDSAFRLVSAETLREILQDKELSKEQLVTFLENVLKTSGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKQIRNGVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENSFTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV..... 468
5 -119.0003ikl_A mol:protein length:459 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  77  51........EGNGEHPEAPGSGEGSEALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGPLLPGDS--------------------------------AFRGGLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKQIRNGVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENSFTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV..... 453
6 -102.0005c53_B mol:protein length:903 Pol gamma B  ali model follow..  71  17LLSGFGGRVDAGQPEEAPGSGEGSEALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGPLLPGDS---------------------------------AFRKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKQIRNGVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENSFTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNVMRS.. 455
7 -99.1001b76_A mol:protein length:442 Glycine--tRNA ligase  ali model follow..  24  1...................AASSLDELVALCKRRGFIFQSSEIYGGLQGV----YDYGPLGVELKNNLKQAWWRRNVYERDDMEGLDASVLTHRLVLHYSGHEATFADPMVDNAKARYWTPPRYFNMMFQGGRGLLAYLRPETAQGIFVNFKNVLDATSRKLGFGIAQIGKAFR---NEITPRNFIFRVREFEQMEIEYFVRPGEDEYWHRYWVEERLKWWQEMGLSRENLVPYESSAHYAKATVDILYRFPHGSLELEGIAQRTDFDLGSHTKDQEALGITPETGKWFVPYVIEPSAGVDRGVLALLAEAFTREEL----PNGEERIVLKLKPQLAPIKVAVIPLVKNRPEITEYAKRLKARLLALGLGRV---LYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSTVTVRDRDTMEQIRLHVDELEGFLRERLR.......... 441
8 -90.9001ati_A mol:protein length:505 GLYCYL-TRNA SYNTHETASE  ali model follow..  25  1...................AASSLDELVALCKRRGFIFQSSEIYGGLQGV----YDYGPLGVELKNNLKQAWWRRNVYERDDMEGLDASVLTHRLVLHYSGHEATFADPMVDNRITKKRYRLDHLLKEQRGGRGLLAYLRPETAQGIFVNFKNVLDATSRKLGFGIAQIGKAFR---NEITPRNFIFRVREFEQMEIEYFVRPGEDEYWHRYWVEERLKWWQEMGLSRENLVPYESSAHYAKATVDILYRFPHGSLELEGIAQRTDFDLGSHTKDQEALGITARTGKWFVPYVIEPSAGVDRGVLALLAEAFTREEL----PNGEERIVLKLKPQLAPIKVAVIPLVKNRPEITEYAKRLKARLLALGLGR---VLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSTVTVRDRDTMEQIRLHVDELEGFLRERLR.......... 504
9 -87.4002pme_A mol:protein length:693 Glycyl-tRNA synthetase  ali model follow..  18  52........EAKELALQPKDDIVDRAKMEDTLKRRFFYDQAFAIYGGVSGL----YDFGPVGCALKNNIIQTWRQHFIQ-EEQILEIDCTMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRADHLLKAHLQKLMSDGYLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFR---NEISPRSGLIRVREFTMAEIEHFVDPSEKNTVLGYFIGRIYLYLTKVGISPDKLRFRQHMECYITEMEMLLNEKGEFTIETEGKTFQLTKDMINVKRFQKT-----LYVEEVVPNVIEPSFGLGRIMYTVFEHTFHVRE------GDEQRTFFSFPAVVAPFKCSVLPLS-QNQEFMPFVKELSEALTRHGVSH---KVDDSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTTATLRDRDSMRQIRAEISELPSIVQDLANGNITWADVEA 667
10 -29.9005xip_A mol:protein length:498 Prolyl-tRNA synthetase, putative  ali model follow..  11  6...............TAKKSTNFADWYTQVIVRGELVEYYD--------ISGCYI-IRPWAYRIWEAVQKFFDDGIKRLGVENCYFP-MFVSQAKLEKEKDHVEGFKPEV------------AWVTHYGDSELPEKVAIRPTSETIMYPAYAKWIRSHR-DLPLKLNQWNNVVR---WEFKQPTPFLRTREFLWQEGHTAATEEEAYTLVLEILELYRQWYEDYLAVP---VIKGEKSENEKFAGGKKTTTIEGIIPDTGRGIQAATSHLLGQNFSRMFSIEFEDEKGAKQLVHQTSWGCTTRSLGVMIMTHGDDKG------------LVLPPRVVAVQAVIIPIIFKETGIVAKCRELERLLNAAGVRVK--VDDRTNYTPGWKFNDWELKGVPLRLEIGPRDVESCQTRVVRRDTSEARNVPWAEAASTIPAMLETMQK...... 393
11 -29.7004k86_A mol:protein length:535 Proline--tRNA ligase  ali model follow..  10  34...............EAKKEENLADWYSQVITKSEMIE--------YHDISGCYI-LRPWAYAIWEAIKDFFDAEI--KKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRSG-----------KTELAEPIAIRPTSETVMYPAYAKWVQSHR-DLPIKLNQWCNVVR---WEFKHPQPFLRTREFLWQEGHSAATMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAF--SASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGDNMG------------LVLPPRVACVQVVIIPCEEDKEALIAKCNDYRRRLLSVNIRV--RADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILEDIQV...... 427
12 -29.2004ncx_A mol:protein length:506 Proline--tRNA ligase  ali model follow..  11  9...............TSKKIENFSDWYTQVIVKSELIEYYD--------ISGCYI-LRPAAYYIWECVQAFFNKEIKKLNVENSYFPLFVTKN-KLEKEKNHIEGFSPEV------------AWVTKYGDSNLPEEIAIRPTSETIMYSVFPKWIRSYR-DLPLKLNQWNTVVR---WEFKQPTPFIRTREFLWQEGHTAKNEEEAVKLVFDILDLYRRWYEEYLAVPIIKGIKSEGEKFGGANFTSTAEAFIS-ENGRAIQAATSHYLGTNFAKMFKIEFEDENEVKQY--VHQTSWGCTTRSIGIMIMTHGDDKG------------LVLPPNVSKYKVVIVPIFYKTTDIHSYCKDIEKILKNAQINCV--YDDRASYSPGYKFNHWELRGIPIRIEVGPKDLQNNSCVIVRRDNNEKCNVKKESVLLETQQMLVDIHK...... 396
13 -28.8005xif_A mol:protein length:500 Prolyl-tRNA synthetase (ProRS)  ali model follow..  13  5...............TAKKDENFSEWYTQAIVRSEMIEYYD--------ISGCYI-MRPWAFHIWEKVQRFFDDEIKKMGVENSYFPMFVSRH-KLEKEKDHVEGFSPEV------------AWVTHYGDSPLPEKIAIRPTSETIMYPAYAKWIRSHR-DLPLKLNQWCSVVR---WEFKQPTPFLRTREFLWQEGHTAATEEEAWELVLDILELYRRWYEECLAVPVIKG-EKSEGEKFAGGKKTTTVEAFIPENGRGIQAATSHLLGTNFAKMFEIEFEDEEGHKR--LVHQTSWGCTTRSLGVMIMTHGDDKG------------LVIPPRVASVQVVIIPIDENTGEILGKCRELKTMLEKADIRVR--IDDRSNYTPGWKYNHWEVKGVPLRLELGPKDLAKGTARVVRRDTGEAYQISWADLAPKLLELMEGIQR...... 392
14 -28.7004hvc_A mol:protein length:519 Bifunctional glutamate/proline--tRNA ligase  ali model follow..  10  5..EGQGPKKQTRLGLEAKKEENLADWYSQVITKSEMIE--------YHDISGCYI-LRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRSGK-------------TELAEPIAIRPTSETVMYPAYAKWVQSHR-DLPIKLNQWCNVVR---WEFKHPQPFLRTREFLWQEGHSAATMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEA-FISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGDNMG------------LVLPPRVACVQVVIIPCGITNEALIAKCNDYRRRLLSVNIRVR--ADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILEDIQV...... 411
15 -28.1001nj1_A mol:protein length:501 Proline-tRNA Synthetase  ali model follow..  12  10PRGSHMQKPIKKDPNRYHGEKMT-----EFSEWFHNILEEAEIIDQRYPVKGMHV-WMPHGFMIRKNTLKILRRILDRDHEEVL---PLLVPEDELAKEAIHVKGFEDEV------------YWVTHGGLSKLQRKLALRPTSETVMYPMFALWVRSHT-DLPMRFYQVVNTFRYETKHTRP--LIRVREITTFKEATIHATASEAEEQVERAVEIYKEFFNSLGIPYLITRRPPWDKFPGSEYTVAFDTL----PDGKTLQIGTVHNLGQTFARTFEIKFETPEGDHEYVHQT--CYGLSDRVIASVIAIHGDESG------------LCLPPDVAAHQVVIVPIKKAAEEVMEACRELRSRLEAAGFRV---HLDDRDIRAGRKYYEWEMRGVPLRVEIGPRDLEKGAAVISRRDTGEKVTADLQGIEETLRELMKDILE...... 411
16 -27.7005f9y_A mol:protein length:511 Aminoacyl-tRNA synthetase  ali model follow..  12  2....ASKENESLLGITADKITSFADWYSQVIVKSEMIEYYD--------ISGCYI-LRPWSYFIWETIQSVFDQKIKQHDVQNAYFP-IFVTQKKLETEKDHVEGFSPEV------------AWVTKSGKSDLAEPIAIRPTSETIMYPYFAKWIRSHR-DLPLKINQWTSIVR---WEFKHPTPFIRTREFLWQEGHTASTRKEALEMVDIILNEYASIYEDLLATPVVKGTKSENEKFPGGDITKSIEG----EIGRAVQAATSHLLGQNFSKMFGVEFEDEKGNKEY--AHQTSWGLTTRAIGVMIMTHGDNKG------------LVLPPKVAPVQVIIIPITVITEEQKKICNEVECILKKAGVRV--KIDDRSNYTPGWKYNHWEVKGVCLRFEVGPRDIEKRSVRVVVRDNMEKMDIPISELESKIPKLLEEFQN...... 400
17 -26.8002i4l_A mol:protein length:458 Proline-tRNA ligase  ali model follow..  11  10PRGSHMRLSRFFLPILKENPKEAEIVSHRLMLRAGMLRQEA---------AGIYA-WLPLGHRVLKKIEQIVREEQ--NRAGAIELLMPTLQLADLWRESGRYDAYGPEMLR----------------IADRHKRELLYGPTNEEMITEIFRAYIKSYK-SLPLNLYHIQWKFR---DEQRPRFGVMRGREFLMKDAYSFDVDEAARKSYNKMFVAYLRTFARMGLKAIPMRA-ETGPIGGDLSHEFIVLAETGESGVRGIEVGQIFYFGTKYSDSMKANVTGPDGTDAPIHGGSYGVGVSRLLGAIIEACHDDNG-------------IIWPEAVAPFRVTILNLKQGDAATDAACDQLYRELSAKGVDV---LYDDTDQRAGAKFATADLIGIPWQIHVGPRGLAEGKVELKRRSDGARENLALADVVARLT.............. 452
18 -25.9005xil_A mol:protein length:512 Putative prolyl-tRNA synthetase  ali model follow..  10  4.............GIAAKREENFSAWYIDVITKAEMIEYYD--------VSGCYI-IRPWAYYVWKCVQRFLGGKIEKLGVEDCYFP-MFVSRSCLEREKDHIEGFAPEV------------AWVTRAGDTELEQPVAVRPTSETVMYPYYAKWIRSHR-DLPVRLNMWNNVIR---WEFSHPTPFIRTREFLWQEGHCAAKAEECAKEVLEILECYASVYEQLLAVPVVRGRKTEKEKFAGGDYTTTVET---EAVGRGCQGATSHNLGQNFGKMFDIRFQDPENNEQTLIPWQNSWGLSTRVIGVMIMVHGDNRG------------MVMPPRVASTQVIIIPVEEARQELLASCWRLESELCEGGVRA--RCDLRDNYSPGWRFNHWEVKGVPLRVELGPRELAERSLAVAVRHSGARHSVAWDAQTPAAVAALLEDVH...... 399
19 -25.6003ial_A mol:protein length:518 Prolyl-tRNA synthetase  ali model follow..  11  2......AMGGDVTFSLTKTRDTFADWFDAIMDAAELVDRRYPV-------KGCVV-FRPYGFFMENAIMRLCEEEYAKVGISQILFPTVIPES--LKKESDHIKGFEAEC------------FWVEKGGLQPLEERLALRPTSETAIYSMFSKWVRSYK-DLPLKIHQTCTIFR---HETKNTKPLIRVREIHWNEAHCCATAEDAVSQLSDYWKVIDTIFSDELCFKGQKLRRVCWDRFPGADYSEVSD-----PCGRVLQTAGIHNLGQRFSSTFDILYANKANESVHPYLT--CAGISTRVLACALSIHGDSGG------------LVLPPLIAPIHVVIIPIGCGKKNNQESDQQVLGKVNESKLGLRVSIDDDFSKSMGDKLYYYELKGVPLRIEVGQRDLANGQCIVVPRDVGKDQKIPITEVMKVSSHTTENHEL...... 405
20 -25.1001nj8_A mol:protein length:459 Proline-tRNA Synthetase  ali model follow..  13  1................GSHMLEFSEWYSDILEKAEIY-------DVRYPIKGCGV-YLPYGFKIRRYTFEIIRNLLDESGHDEALFPMLIPED---------------AKEAEHIKGFEDEVYWVTHGGKTQLDVKLALRPTSETPIYYMMKLWVKVHT-DLPIKIYQIVNTFR---YETKHTRPLIRLREIMTFK-TAHSTKEEAENQVKEAISIYKKFFDTLGIP---YLISKRPEWDKFPGAEYTMAFDTIFPDGRTMQIATVHNLGQNFSKTFEIIFETPTGDK--DYAYQTCYGISDRVIASIIAIHGDEKG------------LILPPIVAPIQVVIVPLIFKGKEVMEKAKEIYEKLKGK----FRVHIDDRDIRPGRKFNDWEIKGVPLRIEVGPKDIENKKITLFRRDTMEKFQVDETQLMEVVEKTLNNIME...... 384
21 -25.0001h4q_A mol:protein length:477 PROLYL-TRNA SYNTHETASE  ali model follow..  14  8................TPQSQDFSEWYLEVIQKAELA---------YGPVRGTIV-VRPYGYAIWENIQQVLDRMFKETGHQNAYFPLFIPMS-FLRKEAEHVEGFSPEL------------AVVTHAGGEELEEPLAVRPTSETVIGYMWSKWIRSWR-DLPQLLNQWGNVVRWEMRT----RPFLRTSEFLWQEGHTAATREEAEEEVRRMLSIYARLAREYAAIPVIEGLKTEKEKFAGAVYTTTIEA----KDGKALQAGTSHYLGENFARAFDIKFQDRDLQVKYVH--TTSWGLSWRFIGAIIMTHGDDRG------------LVLPPRLAPIQVVIVPIDESRERVLEAAQGLRQALLAQGLRV--HLDDRDQHTPGYKFHEWELKGVPFRVELGPKDLEGGQAVLASRLGG-KETLPLAALPEALPGKLDAFHE...... 390
22 -24.1002j3l_A mol:protein length:572 PROLYL-TRNA SYNTHETASE  ali model follow..  9.............PTLREVPNDAEVLSHQILLRAGYIRQ----------VAAGIYSYLPLANRVLEKLKTIMREEF--EKIDAVEMLMPALLPAELWKESGRYETYGPNLYRLKDRN-----------------DRDYILGPTHEETFTELIRDEINSYKRLPLNLYQIQTKYR---DEKRSRSGLLRGREFIMKDGYSFADEASLDQSYRDYEKAYSRIFERCGL-EFRAIIGDGGAMGGKDSKEFMAISEIGEDTICYSTESDYAANLEMATSLYTPKKSHETQLDLEKI-LAFTKGIEIGHIFKLGTRYSDAMGATVLDENGREKSVIMPTGIAPFDLHVVQMNVKDEYQTKLSQEVEAMMTEAGYEVL---VDDRNERAGVKFADADLIGCPIRITVGKKAVD-GVVEVKIKRTGEMLEVRKEELESTLSILMNTTSEVE.... 572
23 -23.0005ucm_A mol:protein length:579 Proline--tRNA ligase  ali model follow..  13  11.............STLKETPADAVVISHQLLLRAGMIRR----------LASGLYTWLPMGLRVLRKVETIVREEM--NAAGALEVLMPAVQPAELWQESGRWEQYGPELLRLKDRH-----------------EREFCVGPTHEEVITDLARNELNSYKQLPINFYQIQTKFR---DEIRPRFGLMRGREFIMKDAYSFLSQDSLQQTYDGMYQAYSKIFSRLGL-DFRPVQADNGSIGGSGSHEFHVLANSGEDDIKTIAALVDGFQLPIEKTIKTLVVHGAEEGTLVALILVIKRGIEVGHIFQLGTKYSEAMKLSVLSEQGKPVNLIMPSALAPFQIALVPLKYETESVKQATDKLYAELTAAGFEVLLD-DRDKKTSPGVKFADMELIGIPHRIVISDRGLSEGVLEYKGRRDSESQNLPIGELMSFITEKLSR......... 573
24 -19.3001nyq_A mol:protein length:645 threonyl-tRNA synthetase 1  ali model follow..  11  205WRGDSNNKMLQRIYGTAFFDKKELKAHLQMLEERK-IGKELELFTNSQLVGAGLPLWLPNGATIRREIERYIVD--KEVSMGYDHVYTPVLANVDLYKTSGHWDHY---------------QEDMFPPMQLDETESMVLRPMNCPHHMMIYANKPHSYR-ELPIRIAELGTMHRYEASGAV--SGLQRVRGMTLNDSHIFVRPDQIKEEFKRVVNMIIDVYKDFGFEDYSFRLSYRDPEDKEKYFDDDDMWNKAENMLKEAADESTAQLDFLLPERFDLTYIGQDGEHHRPVVIHRGVTMER-FVAFLTEETK-----------------AFPTWLAPKQVQIIPVNVDLHY--DYARQLQDELKSQGVRV----IDDRNEKMGYKIREAQMQKIPYQIVVGDKEVENNQVNVRQYGSQDQETVEKDEFIWNLVDEIRLKK....... 643
25 -19.1004p3n_A mol:protein length:415 Threonine--tRNA ligase, cytoplasmic  ali model follow..  12  1...........................MGSSSSGDHIGRDQELYFFHELSPGSCF-FLPKGAYIYNALIEFIRSEY--RKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFSFEVEKELFA-----------------LKPMNCPGHCLMFDHRPRSWR-ELPLRLADFGVLHRNELSGAL--TGLTRVRRFQQDDAHIFCAMEQIEDEIKGCLDFLRTVYSVFGTRPEKFLGDIEVWDQAEKQLE-EFGEKWELNSGDGAFYGPKIDIQIKDAIGRYTYVSHDGDDKKRPVIVHRAISVER-MIAILTENYG-----------------KWPFWLSPRQVMVVPV---GPTCDEYAQKVRQQFHDAKFMA--DIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERTISETIERLQQLKEFRS....... 402
26 -18.9004hwt_A mol:protein length:413 Threonine--tRNA ligase, cytoplasmic  ali model follow..  13  1.............................MARDHRKIGRDQELYFFHELSPGSCF-FLPKGAYIYNALIEFIRSEY--RKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFSFEVEKELFA-----------------LKPMNCPGHCLMFDHRPRSWR-ELPLRLADFGVLHRNELSGAL--TGLTRVRRFQQDDAHIFCAMEQIEDEIKGCLDFLRTVYSVFGFSPEKFLGDIEVWDQAEKQLE-EFGEKWELNSGDGAFYGPKIDIQIKDAIGRYTYVSHDGDDKKRPVIVHRAISVER-MIAILTENYG-----------------KWPFWLSPRQVMVVPV---GPTCDEYAQKVRQQFHDAKFMA--DIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERTISETIERLQQLKEFRS....... 398
27 -18.6002lw7_A mol:protein length:170 Histidine--tRNA ligase, cytoplasmic  ali model follow..  17  79..............................................................................................................................................................................................................................................................................................................................................................KKLLEERLKLVSELQDAGIKA--ELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQPLSIS.... 170
28 -18.1003a31_A mol:protein length:471 Probable threonyl-tRNA synthetase 1  ali model follow..  10  4...............GQDKTHIDYAYELDITVKPDSRVPVFNREFATFTGAGVPL-FSLGGGPIRYALAEVLAKFH--ARRGYYVVETPIIASTELFKVSGHIEFYRNNM-----------------YLFDIEGHEFAVKPMNCPYHILLFLNEVAKHRSPLPFKVFEFGRVHRYEPSGSI--YGLLRVRGFTQDDAHIIVPGGRVIDVVYDVFEEMKLVLERLFKSKEEWEGAEEALREAASRINEKYGIDIVELEGEAAFYGPKLDFINLPRRFRLYDVVREEFGIEEVYIIHRALSIER-FLGVYLEHRR-----------------RMPFTLAPIQFAVIAVKTGGREIEDLASSIAKGLLDKGFRV--AVKGSSKTGLSSDVRHIESTAKPANVFIGAKEVREKVLDVRVFDLESMKRRRLAIAYGDAADAVENLAAVAEELE 450
29 -17.4004hwo_A mol:protein length:411 Threonine--tRNA ligase  ali model follow..  12  1.............................MARDHRKIGKQLDLYHMQEEAPGMVF-WHNDGWTIFRELEVFVRSKL--KEYQYQEVKGPFMMDRVLWEKTGHWDNYKDAM-----------------FTTSSENREYCIKPMNCPGHVQIFNQGLKSYR-DLPLRMAEFGSCHRNEPSGSL--HGLMRVRGFTQDDAHIFCTEEQIRDEVNGCIRLVYDMYSTFGFEKIVVKLSEADLAVALEENNIPFEYQLGYDCLDRAWQCGTVQLDFSLPSRLSASYVGEDNERKVPVMIHRAISMER-FIGILTEEFA-----------------FFPTWLAPVQVVIMNI---TDSQSEYVNELTQKLSNAGIRV----ADLRNEKIGFKIREHTLRRVPYMLVCGDKEVESGKVAVRTRRGKDLGSMDVNEVIEKLQQEIRSRS....... 397
30 -16.9001qf6_A mol:protein length:642 THREONYL-TRNA SYNTHETASE  ali model follow..  12  206WRGDSNNKMLQRIYGTAWADKKALNAYLQRLEEHRKIGKQLDLYHMQEEAPGMVF-WHNDGWTIFRELEVFVRSKL--KEYQYQEVKGPFMMDRVLWEKTGHWDNYKDAMFTTSSENREYC-----------------IKPMNCPGHVQIFNQGLKSYR-DLPLRMAEFGSCHRNEPSGSL--HGLMRVRGFTQDDAHIFCTEEQIRDEVNGCIRLVYDMYSTFGFEKIVVKLSEADLAVALEENNIPFEYQLGYDCLDRAWQCGTVQLDFSLPSRLSASYVGEDNERKVPVMIHRAISMER-FIGILTEEFA-----------------FFPTWLAPVQVVIMNI---TDSQSEYVNELTQKLSNAGIRV----ADLRNEKIGFKIREHTLRRVPYMLVCGDKEVESGKVAVRTRRGKDLGSMDVNEVIEKLQQEIRSRS....... 636
31 -16.4003ugq_A mol:protein length:460 Threonyl-tRNA synthetase, mitochondrial  ali model follow..  10  1.MGSSSSGLVPRGSHMASATKNASSATPATMTSM--VSQRQDLFMTDPLSPGSMF-FLPNGAKIFNKLIE-FMKLQQKFKFGFNEVVTPLIYKKTLWEKSGHWENY--------------ADDMFKVETTDEEKEEYGLKPMNCPGHCLIFGKKDRSYN-ELPLRFSDFSPLHRNEASGAL--SGLTRLRKFHQDDGHIFCTPSQVKSEIFNSLKLIDIVYNKIFPFVKGGSGAESNYFINFSTRPDHF---------LKVWNHAEQVLKEILEESGKPWKLNPGDGAFYPKLVTDHLRKTHQVATIQLD--ERFDLKFKDQDNSYKRPIMIHRALNPYQAVIIPVNTKNVQQLDMCTALQKPLNDWHFNV----LDIRNEPVGYRIKSAILKNYSYLIIVGDEEVQLQKYNIRERDNRKSFKLTMSQIWEKFIELEKNYK....... 454
32 -14.6001v95_A mol:protein length:130 Nuclear receptor coactivator 5  ali model follow..  12  8.................................................................................................................................................................................................................................................................................................................................................PVDCSVIVV---NKQTKDYAESVGRKVRDLGMVV--LIFLNTEVSLSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQENMPQADAMVLVARNYERYKN...... 110
33 -12.9001qe0_A mol:protein length:420 Histidine--tRNA ligase  ali model follow..  14  10.......................................................DILPEDSKKWRYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSTDVVQKEMYT----------------FKDKGDRSITLRPEGTAAVVRSYIEHKMQGNPNQPIKLYYNGPMFRYERKQKG------RYRQFNQFGVEAIGAENPSVD--AEVLAMVMHIYQSFGLKHLKLVINSVGDMASRKEYNLDCKVDRDKEAIKTAPRITDFESKAYYEQVKAYLDDLGIPYTEDPNLVRGLDYYTHTAFELMMDNPNYDGAITTLCGGGRYNGLRLLLALEEEGIELDIEENLDDQADRYAVKLLNHLRHNGIKADKDY---LQRKIKGQMKQADRLGAKFTIVIGDQELENNKIDVKNMTTGESETIELDALVEYFKK............. 420
34 -12.3004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  11  23...KLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIR--CFKRHGAEVIDTPVFELKET------------------LMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAM-----NKLTNIKRYHIAKVYRRDNPAMTRG----RYREFYQCDFDIAGNFDPMIP--AECLKIMCEILSSLQIGDFLVKVNDRREEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLIDDKISFDLSLAGVIYEAVLLQTPAQAGEEPLGVGSVRIFSIVEQRLEALEEKIRTTKKLLEERLKLVSELWDAGIKA--ELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQP........ 516
35 -12.0001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  11  14.......................................................DFYPEDMDVEKFIFKTAEEAAEAFGFRRIDFPSLEYLDLYRIKSGEELL-------------------QQTYSFVDKGGREVTLIPEATPSTV---RMVTSRKDLQRPLRWYSFPKVWRYEEPQA-------RYREHYQFNADIFMTSSDPFSVFSIIDRYHKISREEFGIGEDGVSMIADLCSGTRGIDEMARITGKSSEEIARMAAVEDLLASYGVKNVRYDFSIVRGLSYYTGIVFEAYDRSGQF-LASLMSGESVPAVGFGMGDAVISLLLKRENVQIPREKKSVYICRVGKINSSIMNEYSRKLRERGMNVTVEI---MERGLSAQLKYASAIGADFAVIFGERDLERGVVTIRNMYTGSQENVGLDSVVEHLISQATLE........ 428
36 -11.7003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  2........AMGTLEAQTQGPGSMQKNMVETEPVQGC-------------------DFPPEAMRCRRHLFDVFHATAKTFGFEEYDAPVLESEELYIRKAGEEIT-------------------EQMFNFITKGGHRVALRPEMTPSLARLL--LGKGRSLLLPAKWYSIPQCWRYEAITR-------RRREHYQWNMDIVGVKSVSAE--VELVCAACWAMRSLGLSSKDVGIKIVDKMEKIPREEVEAQLAVLGLEPTVVDAITTTLSLKSIDEIAQRVGEEHEAVKELRQFYGDWVLFDASVVGIVFEGFDREGKFRALCGGGRYDNLVIVELLQEKRLLPDIPHVVDESMRPHALAVLRRLRDAGRSADIIL---DKKKVVQAFNYADRVGAVRAVLVAPEEWERGEVQVKMLREGTGKEEGGAERGFAVPL............. 446
37 -11.6005e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  10  14.......................................................DVLPTQTAAWRRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRAIGDATDIVEKEMYTFFDKG--------------NPPESLTLRPEGTAGCVRAL--VEHNLLRGATPRVWYMGPMFRYEKPQKG------RYRQFHQFGVETFLNTLGETDERTEYRNALVAFLNQRRLTTNPLRILDSKIESTQKILE----------NAPKLHDFLKEDSLSHFQQLQDYLTAAGIKFVINQKLVRGLDYYNKTVFEWTTTALGSQGTVCAGGRYDERLLLLLEQVQAEIVRDCEAFLVAEPAYQSKALVLAEQLRDQLEAANSNIRIKSQGSMKSQMKKADQAGAVYAIILGEREWEAQQLAVKELATAEQSQVALAELVPFLIEKFTK......... 432
38 -11.4004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  17  330............................................................................................................................................................................................................................................................................................PKGRKVPCV---SIGVERIFSIV----------------EQRLEALEEKIRTTETQVLVASA---QKKLLEERLKLVSELWDAGIKA--ELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQP........ 463
39 -11.3003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  10  20.......................................................EFLPSEKRLELYLLDTIRRVY-----ESYGFTPIETPAVERLEVLQAKGNQGDNIIYGLEPILPPNRQAEKDKSGDTGSEARALKFDQTVPLAAYI--ARHLNDLTFPFARYQMDVVFRGERAKDG------RFRQFRQCDIDVVGREKLSLLYDAQMPAIITEIFEAVNIGDFVIRINNRKPEQTQKIIDFVKIDGSVDDVLDKLKHLSQTLPESEQFNLGRNLGVPDKRFCIDLAIAR---GLNYYTGTVYETTLIGHEALGSICSGGRYEELTFIGEKMPISIGLVVVVNMQDELMPTYLKVSQQLRQAGLNVITNF---EKRQLGKQFQAADKQGIRFCVIIGADEAAAQKSSLKDLQSGEQVEVALADLAEEIKRRLT.......... 465
40 -11.3003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  10  2........AMGTLEAQTQGPGSMQMNMVETEPVQGC-------------------DFPPETMRLRKYLFDVFHS--TARKFGFEEYDSPVLESEELYIRKAGEEI-----------------TEQMFNFITKGGHRVALRPEMTPSLARQL--LAKGRSLLLPAKWYSIPQCWRYEAITR-------RRREHYQWNMDIIGVKSVSSE--VELVCAACTAMQSLGLSSKDVGVKKMEKLPREEVVAQLAAIGLESNVVDAITSTLSLTIDEIAQRIGEEHEAVRELRDFITQIFGDWVIFDASVVGIVFEGFDRDGNFRALCGGGRYDNLVIVELLNEKKLLPELHHVVDETMRPHALSILRRLRDAGRSADIVF---DKKKVVQAFNYADRIGALRAVLVAPDEWARGEVRVKMLREGAGREEGANERGIVLPV............. 446
41 -11.2004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  11  2......................AMGTLEAQTQGPGSMTEQKRKLEKLTGVKGMN-DILPQDAGLWEFFEATVKSLLRAYGYQNIRTPIVEHTPLFTRGIGEVTDIV---------------EKEMYSFVDALNGENLTLRPENTAAVVRAA--IEHNMLYDGPKRLWYIGPMFRHERPQR-------RYRQFHQVGVEALGFAGPDAD--AEIVMMCQRLWEDLGLTGIKLEINSLGLAEERAAHRLDTKNPALQEIVRNAPKLIDFVSRAHFEGLQRLLKANNVPFTINPRLVRGLDYYNLTVFEWVTDKLGAQGTVAAGGRERILELLKEEHLVPEQEGVDVYVVHQGDAAREQAFIVAERLRDTGLDVILHCSADAGASFKSQMKRADASGAAFAVIFGEDEVTNGTASVKPGEKSVQQSVPVESLTEFLINAMVATAE...... 457
42 -10.3004rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  10  13.......................................................DLFGKELRMHQRIVATARKVLEAAGALELVTPIFEETQVFEKGVGAATDIVRKEMFT----------------FQDRGGRSLTLRPEGTAAMVRAYLE-HGMKVWPQPVRLWMAGPMFRAERPQKG------RYRQFHQVNYEALGSENPILD--AEAVVLLYECLKELGLRRLKVKLSSVGDPEDRARYNLDSKSERDQALLKELGVRPMLDFLGEEARAHLKEVERHLERLSVPYELEPALGLDYYVRTAFEVHHEEIGAQSALGGGGRYDGLRVALALEAEGFGLPEEKGPDEEAVAEAFYLAEALRPR----LRAEYALAPRKPAKGLEEALKRGAAFAGFLGEDELRAGEVTLKRLATGEQVRLSREEVPGYLLQALG.......... 423
43 -10.2003qne_A mol:protein length:485 Seryl-tRNA synthetase, cytoplasmic  ali model follow..  11  133.....PENYKKPEQIAAATGAPAKLSHHEVLLRLDGY-----DPERGVRIVGHRGYF-NYGVFLNQALINYGLSFLS--SKGYVPLQAPVMMNKEVMAKTAQLSQFDEELYKVIDGE----------------DEKYLIATSEQPISAYHAGEWFESPAEQLPVRYAGYSSCFRREAGSHGKDWGIFRVHAFEKIEQFVLTEPEKSWEEFDRMIGCSEEFYQSLGLPYRVVGISGELNNAAAKKYDLEAWFPFQQEYKELVSCSNCTDYQSRNLEIRCGIKQQNQQEKKYVHCLNSTLSATERTICCILENYQKEDG------------LVIPEVLRKY-------IPGEPEFIPYIKELPKNTTSVKKAK-------------------------------GKNPKNTTSVKKAKGKNGSR.......................... 479
44 -9.7702el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  20.......................................................DYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEM-----------------TFEDRNGDSLTLRPEGTAGCVRAG--IEHGLLYNQEQRLWYIGPMFRHERPQKG------RYRQFHQLGCEVFGLQGPDID----ISEHVTLELNSIGSLEARANYRDALVAFLEQHKEKLDEDCKRRMYTNPLRVLDSKNPEVQALLNDAPALGDYLDEESREHFAGLCKLLESAGIAYTLDYYNRTVFEWVTNSLGSQGTVRLVLLVQAVNPEFKADPVVDADTQSAAMALAERLRDELPGVKLMTNHG-GGNFKKQFARADKWGARVAVVLGESEVANGTAVVKDLRSGEQTAVAQDSVAAHLRTLLG.......... 431

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 6 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Awobuluyi M, Yang J, Ye Y, Chatterton JE, Godzik A, Lipton SA, Zhang D. Subunit-specific roles of glycine-binding domains in activation of NR1/NR3N-methyl-D-aspartate receptors. Mol Pharmacol. 2007 Jan;71(1):112-22. Epub 2006 Oct 17.