current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 1gq6_A mol:protein length:313 PROCLAVAMINATE AMIDINO HYDROLASE, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310
# Score Template Links and tools%idFirst MERIDSHVSPRYAQIPTFMRLPHDPQPRGYDVVVIGAPYDGGTSYRPGARFGPQAIRSESGLIHGVGIDRGPGTFDLINCVDAGDINLTPFDMNIAIDTAQSHLSGLLKANAAFLMIGGDHSLTVAALRAVAEQHGPLAVVHLDAHSDTNPAFYGGRYHHGTPFRHGIDEKLIDPAAMVQIGIRGHNPKPDSLDYARGHGVRVVTADEFGELGVGGTADLIREKVGQRPVYVSVDIDVVDPAFAPGTGTPAPGGLLSREVLALLRCVGDLKPVGFDVMEVSPLYDHGGITSILATEIGAELLYQYARAHRTQLLast
1 -111.0001gq6_A mol:protein length:313 PROCLAVAMINATE AMIDINO HYDROLASE  ali model  100  1MERIDSHVSPRYAQIPTFMRLPHDPQPRGYDVVVIGAPYDGGTSYRPGARFGPQAIRSESGLIHGVGIDRGPGTFDLINCVDAGDINLTPFDMNIAIDTAQSHLSGLLKANAAFLMIGGDHSLTVAALRAVAEQHGPLAVVHLDAHSDTNPAFYGGRYHHGTPFRHGIDEKLIDPAAMVQIGIRGHNPKPDSLDYARGHGVRVVTADEFGELGVGGTADLIREKVGQRPVYVSVDIDVVDPAFAPGTGTPAPGGLLSREVLALLRCVGDLKPVGFDVMEVSPLYDHGGITSILATEIGAELLYQYARAHRTQL 313
2 -104.0003nio_A mol:protein length:319 Guanidinobutyrase  ali model follow..  38  7.QPLGGNEMPRFGGIATMMRLPHVAELDALDAAFVGVPLDIGTSLRSGTRFGPREIRAESVMIRPYNMATGAAPFDSLNVADIGDVAINTFNLLEAVRIIEQEYDRILGHGILPLTLGGDHTITLPILRAIKKKHGKVGLVHVDAHADVNDHMFGEKIAHGTTFRRAVEEDLLDCDRVVQIGLRAQGYTAEDFNWSRKQGFRVVQAEECWHKSLEPLMAEVREKVGGGPVYLSFDIDGIDPAWAPGTGTPEIGGLTTIQAMEIIRGCQGLDLIGCDLVEVSPPYDTTGNTSLLGANLLYEMLCVLPGVVRR.. 319
3 -100.0003nip_A mol:protein length:326 3-guanidinopropionase  ali model follow..  43  7.QPLDAAEIPRFAGIPTFMRLPAFTDPAALQVGLIGVPWDGGTTNRAGARHGPREVRNLSSLMRKVHHVSRIAPYDLVRVGDLGDAPVNPIDLLDSLRRIEGFYRQVHAAGTLPLSVGGDHLVTLPIFRALGR-ERPLGMVHFDAHSDTNDRYFDNPYTHGTPFRRAIEEGLLDPLRTVQIGIRGSVYSPDDDAFARECGIRVIHMEEFVELGVEATLAEARRVVGAGPTYVSFDVDVLDPAFAPGTGTPEIGGMTSLQAQQLVRGLRGLDLVGADVVEVSPPFDVGGATALVGATMMFELLCLLAESAARS. 317
4 -97.9004dz4_A mol:protein length:324 Agmatinase  ali model follow..  37  19.SVYGSSIENTYAGVLSFMRRNYTRDLDGVDVVVSGVPLDLATTFRSGARLGPSAVRAASVQLAELNPYPWFDPFDDLAVIDYGDCWFDAHHPLSIKPAIVEHARTILQSDARMLTLGGDHYITYPLLIAHAQKYGPLSLIHFDAHCDTWADDAPDSLNHGTMFYKAVKDGLIDPKASVQVGIRTWNDD--------YLGINVLDAAWVHEHGARATLERIESIVGGRPAYLTFDIDCLDPAFAPGTGTPVAGGLSSAQALAIVRGLGGVNLIGADVVEVAPAYDQSEITAIAAAHVACDLLCLWRQRKAGA. 323
5 -92.4001wog_A mol:protein length:305 agmatinase  ali model follow..  28  1...MSGPAHLPYGGIPTFARAPLVQPDGQADVAALGVPFDIALGFRPGARFAPRALREASLRSVPPFTGLDGKTLQGVTFADAGDVILPSLEPQLAHDRITEAARQVRGRCRVPVFLGGDHSVSYPLLRAFAD-VPDLHVVQLDAHLDFTDTRNDTKWSNSSPFRRACEA-LPNLVHITTVGLRGLRFDPEAVAAARARGHTIIPMDDVTADL----AGVLAQLPRGQNVYFSVDVDGFDPAVIPGTSSPEPDGLTYAQGMKILAAAANNTVVGLDLVELAPNLDPTGRSELLMARLVMETLCEVFDHV.... 304
6 -91.9003lhl_A mol:protein length:287 Putative agmatinase  ali model follow..  26  2.......................SLNYEESNLIVFGVGFDGTTSNRPGARFASSSMRKEFYGLETYSPFLDLDLED-YNICDYGDLEISVGSTEQVLKEIYQETYKIVRDSKVPFMIGGEHLVTLPAFKAVHEKYNDIYVIHFDAHTDLREEYNNSKNSHATVIKRIWD--IVGDNKIFQFGIRSG--TKEEFKFATEEKHTYMEIGGI------DTFENIVNMLNGKNIYLTIDLDVLDASVFPGTGTPEPGGVNYREFQEIFKIISNINIVGCDIVELSPDYDTTGVSTVIACKILRELCLIISDKIKE.. 280
7 -91.8003pzl_A mol:protein length:313 Agmatine ureohydrolase  ali model follow..  29  6....NGREKDHASELRSIFSLKKVNGYEEAKYVVFGIPFDNTSSYRRGSKYAPDSIRGAYVNLESYEYSYGIDLLA-SGMADLGDMEE-SEDVEYVIDTVESVVSAVMSDGKIPIMLGGEHSITVGAVRALPK---DVDLVIVDAHSDFRSSYMGNKYNHACVTRRALD--LLGEGRITSIGIRSV--SREEFEDPDFRKVSFISSFDVKKNGIDKYIEEVDR--KSRRVYISVDMDGIDPAYAPAVGTPEPFGLADTDVRRLIERL-SYKAVGFDIVEFSPLYD-NGNTSMLAAKLLQVFIASREKYYKEH. 304
8 -86.6003m1r_A mol:protein length:322 Formimidoylglutamase  ali model follow..  26  12....EAGSSFKDRDVTKMSDLIATDGQDIKGPALIGVPLSKSSISHSGASFAPGTIRQALKHSSAYSAELGEHVVS-ELLYDLGDIDIHVTDIVKSHHHIFQTMHALLSDHPVPLILGGDNSISYSTIKAIAQTKGTTAVIQFDAHHDVRNTEDG-GPTNGTPFRRLLDEEIIEGQHLIQLGIREFSNSQAYEAYAKKHNVNIHTMDMIREKGLIPTIKEILPVVQDDFIFISVDMDVLDQSHAPGCPAIGPGGLYTDELLEAVKYIQQPNVAGIEIVEVDPTLDFRDMTSRAAAHVLLHALKGMKLSPFK.. 322
9 -85.5002a0m_A mol:protein length:316 ARGINASE SUPERFAMILY PROTEIN  ali model follow..  23  4.........AARTDDPRLLSLFSAQREEDADIVIIGFPYDEGCGGRAGAKKGPAAFRFFLQRLGSVNNLELNVDASHLKLYDAGDITAS--TLEEAHEKLESKVFTVLARGAFPFVIGGGNDQSAPNGRAMLRAFGDVGVINVDSHLDVRPPLQDGRVHSGTPFRQLLEESSFSGKRFVEFACQGSQCGALHAQYVRDHQGHLMWLSEVRKKGAVAALEDAFGLTGK-NTFFSFDVDSLKSSDMPGVSCPAAVGLSAQEAFDMCFLAKTPTVMMMDMSELNPLVE-EYRSPRVAVYMFYHFVLGFATRPKPK. 307
10 -80.8004rhm_A mol:protein length:351 Arginase  ali model follow..  20  1.......MGSSSSGLVPRGSHMF-------SKFLMNVKGVTPRGSDWANRLGPVALFGYGAGMPRRAPLLDCDHYAELTIHDKGPIECPPETSDEWYLGSLEASTELLEKGYVPVSVGGDGSATLSMVEAYKRLFDDIVIVHFDAHPDVSD--------PRSPLRVLLDKGLL--KGVVSVGNRQV--SSEDRKVRKLHKMFYMDMHAIYSKG----LFCIRDIRNDYPVFISIDADVLDPAFAPAVDSPVAGGLSTRDLLHIMNGIRGPKVVGIDVYGYNPDLDNVGLTAIALSKIIKEGILKAYSISTHT. 320
11 -78.6004rhi_A mol:protein length:351 Arginase  ali model follow..  20  1.......MGSSSSGLVPRGSHMFS---KFLMNVKGVTPRG----SDWANRLGPVALFGYGAGMPRRAPLLDCDHYAELTIHDKGPIECPPETSDEWYLGSLEASTELLEKGYVPVSVGGDGSATLSMVEAYKRLFDDIVIVHFSARPSVSD--------PRSPLRVLLDKGLL--KGVVSVGNRQV--SSEDRKVRKLHKMFYMDMHAIYSKG----LFCIRDIRNDYPVFISIDASVLDPAFAPAVDSPVAGGLSTRDLLHIMNGIRGPKVVGIDVYGYNPDLDNVGLTAIALSKIIKEGILKAYSISTHT. 320
12 -73.3001pq3_A mol:protein length:306 Arginase II, mitochondrial precursor  ali model follow..  25  2..............................SVAVIGAPFSQG-QKRKGVEHGPAAIREAGLMKRLSSLGCHLKDFGDLSFTLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDHSLAIGTISGHARHCPDLCVVWVDAHADINTPLTTSGNLHGQPVSFLLRELCISSASIVYIGLRDV--DPPEHFILKNYDIQYFSMRDIDRLGIQKVMERTFDLLRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIAEEIHNTLLSALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTRE.. 305
13 -73.1001t5f_A mol:protein length:314 Arginase 1  ali model follow..  25  2..............................PIEIIGAPFSKGCP-RGGVEKGPAALRKAGLVEKLKETEYNVRDHGDLAFVDVPNDSPNPRSVGKANEQLAAVVAETQKNGTISVVLGGDHSMAIGSISGHARVHPDLAVIWVDAHTDINTPLTTSSGNAGQPVAFLLKELAISAKDIVYIGLRDV--DPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLKKRPIHLSFDVDGLDPVFTPATGTPVVGGLSYREGLYITEEIYKTLLSGLDIMEVNPTLGKTPEEVTRTVNTAVALTLSAFGTKRE.. 304
14 -72.6001d3v_A mol:protein length:323 PROTEIN (ARGINASE)  ali model follow..  25  2.........................SSKPKPIEIIGAPFSKG-QPRGGVEKGPAALRKAGLVEKLKETEYNVRDHGDLAFVDVPNDSPNPRSVGKANEQLAAVVAETQKNGTISVVLGGDHSMAIGSISGHARVHPDLCVIWVDAHTDINTPLTTSGNLHGQPVAFLLKELCISAKDIVYIGLRDV--DPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLKKRPIHLSFDVDGLDPVFTPATGTPVVGGLSYREGLYITEEIYKTLLSGLDIMEVNPTLGKTPEEVTRTVNTAVALTLSCFGTKRE.. 309
15 -71.9001wva_A mol:protein length:322 Arginase 1  ali model follow..  25  2.........................SAKSRTIGIIGAPFSKG-QPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTSGNLHGQPVSFLLKELCISAKDIVYIGLRDV--DPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLARE.. 309
16 -71.2005ynl_A mol:protein length:362 Arginase  ali model follow..  18  19.KFERQHMDSPDLGTDDDDKMSPATLATPRTAGIVGCPFSGG-QPKAGVHSGPLQLIESGLLNDIENLGWTVDALAVSIVSDTPDPDIGRLKVSRVTKDVADRVYAHASKGQLTVTLGGDHSLAMGTVSGTFKAYPEACLIWVDAHADINTPHTTSGRLHGCPVSFLLGLDCLKPERIVYIGLRDI--DAGERKILKDNNIKCFSMFHVDKYGIGKVVEMALDHVRTRPIHLSFDVDALDPSVAPSTGTAVRGGLTFREGHYICEAIETNLLVSLDIMEINPSLGALASVA-QTVDVGRSLVRCALGET.... 354
17 -70.2002eiv_A mol:protein length:291 Arginase  ali model follow..  28  3..............................RVAVVGVPMDLGAN-RRGVDMGPSALRYARLLEQLEDLG--------YTVEDLGDVPVSLARASRAAALVLKERLAALPEGVFPIVLGGDHSLSMGSVAGAAR-GRRVGVVWVDAHADFNTPESPSGNVHGMPLAVLSGLGAVDPKDVVLVGVRSL--DPGEKRLLKEAGVRVYTMHEVDRLGVARIAEEVLKHLQGLPLHVSLDADVLDPTLAPGVGTPVPGGLTYREAHLLMEILESGRVQSLDLVEVNPILDERNRTAEMLVGLALSLLGKRI....... 290
18 -69.5001xfk_A mol:protein length:336 Formimidoylglutamase  ali model follow..  19  16.DPEDGQAGRRVHHIACPIQVGELAN-QEPGVALIGFECDAGVKGRTGAKHAPSLIKQALANLAWH---------HPIPIYDLGNIRCEGDELEQAQQECAQVIQQALPHA-RAIVLGGGHEIAWATFQGLAQHFPRIGIINFDAHFDLRSELAPVRPSSGTPFNQIHHFCQQQDFHYACLGVSRASNTPALFERADKLGVWYVEDKAFSPLSLKDHLTQLQHFIDDDYLYLTIDLDVFPAASAPGVSAPAARGVSLEALAPYFDRILHYKLMIADIAEYNPSFDIDQHTARLAARLCWDIANAMAEQVQSI. 333
19 -66.5006dkt_A mol:protein length:296 Arginase  ali model follow..  25  2............................DKTISVIGMPMDLGQA-RRGVDMGPSAIRYAHLIERLSDMGYTVEDLGDIPIIKNDEELKNLNSVLAGNEKLAQKVNKVIEEKKFPLVLGGDHSIAIGTLAGTAKHYDNLGVIWYDAHGDLNTLESPSGNIHGMPLAVSLGIGKIKPENVVIIGARSL--DEGERKYIKESGMKVYTMHEIDRLGMTKVIEETLDYLACDGVHLSLDLDGLDPNDAPGVGTPVVGGISYRESHLAMEMLYDAIITSAEFVEVNPILDHKNKTGKTAVELVESLLGKKL....... 295
20 -66.1001cev_A mol:protein length:299 PROTEIN (ARGINASE)  ali model follow..  25  3..............................PISIIGVPMDLGQT-RRGVDMGPSAMRYAGVIERLERLHYDIPIGKAERLHEQGDSRLRNKAVAEANEKLAAAVDQVVQRGRFPLVLGGDHSIAIGTLAGVAKHYERLGVIWYDAHGDVNTAESPSGNIHGMPLAASLGFGKIKPEHVVLIGVRSL--DEGEKKFIREKGIKIYTMHEVDRLGMTRVMEETIAYLKEDGVHLSLDLDGLDPSDAPGVGTPVIGGLTYRESHLAMEMLEAQIITSAEFVEVNPILDERNKTASVAVALMGSLFGEKL....... 298
21 -65.4004q3p_A mol:protein length:385 Arginase  ali model follow..  22  8LVPRGSHMMLKSVATPYYPIQDEKPKLLYTSANFLGIPTNRG-QPKIGTYQGPELIRKSNFFQLVAEDGIQLTDCGDIIPVELNEAEDPQRRVEELMKQSNKHTVELSGSKSTPVIVGGDHSMATGTILGHAEAKPDLCVLWIDAHGDINTPLNSSGNMHGMPLSFLVKELCLNASNIAYIGLRDL--DAHETHDIRKHGIAYFTMLDVDRMGIEAVIKEALLAVLEKAIHLSFDIDALDPLVAPSTGTAVPGGLTLREGLRICEEVSATKLSVVELAELNPLLGSQEKTQSSAVHILRACLGHCRSGHLPF. 358
22 -64.8004ity_A mol:protein length:330 Arginase  ali model follow..  21  3........................GSGMAKKMSIVLAPFSGGQP-HSGVELGPDYLLKQGLQQDMEKLGWDTKVVEARKASDNGDRIGRVKRTAECTEKIYKCVRRVAEQGRFPLTIGGDHSIALGTVAGVLSVHPDAGVIWVDAHADINTMSGTSGNLHGCPLSILLGLDVLKPNKIAYIGLRAV--DDEEKKILHDLNIAAFSMHHVDRYGIDKVVSMAIEAVGTEPVMVSYDVDTIDPLYVPATGTPVRGGLSFREALFLCERIECGRLVALDVVECNPLLAATESHVNDTISVGCAIARCMMGETLLY. 316
23 -62.8004g3h_A mol:protein length:330 Arginase (RocF)  ali model follow..  17  1...............................MILVGLEAELGAS-KRGTDKGVRRLREALSATHGDVIKQTITQERCVLYKEFRYAKNFEDYYLFCKENLIPCMKEVFEKKEFPLILSSEHANMFGIFQAFRSVHKKIGILYLDAHADIHTAYDSSKHIHGMPLGMVLNRVEIDPKCLVYFGVRST--EQSERDVIRELQIPLFSVDAIRE-NMQEVVQKTKESLAVDIIYLSLDLDIMDGKLFTSTGVRENNGLSFDELKQLLGLLLESRLKAVEVTEYNPTVSIKHNNEKQVLEILDLIINSCKIKDKKH. 316
24 -59.2003mmr_A mol:protein length:413 Arginase  ali model follow..  20  76.....................KKTNNYINNNDNNNDNNNDNNNDNNNNCYIPNGVIKEKKHDLSNNKMNNFYGNYEENNVISTNDKYKNNCEIGIFSKNLFDTMSNELRKKNFVLNIGGDHGVAFSSILSSLQMYQNLRVIWIDAHGDINIPESPSGNYHGMTLAHTLNLTYLKPENTAIIGIRDI--DAYEKIILKKCNINYYTIFDIEKNGIYNTICTALEKISNCPIHISLDIDSVDNVFAPGTGTVAKGGLNYREINLLMKILETKRVVSMDLVEYNPSLDEVDKKVHGDSLPILDNATKTGKLCLELI 398

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 0 8 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.