current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 1h4q_A mol:protein length:477 PROLYL-TRNA SYNTHETASE, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .
# Score Template Links and tools%idFirst MAKEKGLTPQSQDFSEWYLEVIQKAELADYGPVRGTIVVRPYGYAIWENIQQVLDRMFKETGHQNAYFPLFIPMSFLRKEAEHVEGFSPELAVVTHAGGEELEEPLAVRPTSETVIGYMWSKWIRSWRDLPQLLNQWGNVVRWEMRTRPFLRTSEFLWQEGHTAHATREEAEEEVRRMLSIYARLAREYAAIPVIEGLKTEKEKFAGAVYTTTIEALMKDGKALQAGTSHYLGENFARAFDIKFQDRDLQVKYVHTTSWGLSWRFIGAIIMTHGDDRGLVLPPRLAPIQVVIVPIYKDESRERVLEAAQGLRQALLAQGLRVHLDDRDQHTPGYKFHEWELKGVPFRVELGPKDLEGGQAVLASRLGGKETLPLAALPEALPGKLDAFHEELYRRALAFREDHTRKVDTYEAFKEAVQEGFALAFHCGDKACERLIQEETTATTRCVPFEAEPEEGFCVRCGRPSAYGKRVVFAKAYLast
1 -150.0001h4q_A mol:protein length:477 PROLYL-TRNA SYNTHETASE  ali model  100  1MAKEKGLTPQSQDFSEWYLEVIQKAELADYGPVRGTIVVRPYGYAIWENIQQVLDRMFKETGHQNAYFPLFIPMSFLRKEAEHVEGFSPELAVVTHAGGEELEEPLAVRPTSETVIGYMWSKWIRSWRDLPQLLNQWGNVVRWEMRTRPFLRTSEFLWQEGHTAHATREEAEEEVRRMLSIYARLAREYAAIPVIEGLKTEKEKFAGAVYTTTIEALMKDGKALQAGTSHYLGENFARAFDIKFQDRDLQVKYVHTTSWGLSWRFIGAIIMTHGDDRGLVLPPRLAPIQVVIVPIYKDESRERVLEAAQGLRQALLAQGLRVHLDDRDQHTPGYKFHEWELKGVPFRVELGPKDLEGGQAVLASRLGGKETLPLAALPEALPGKLDAFHEELYRRALAFREDHTRKVDTYEAFKEAVQEGFALAFHCGDKACERLIQEETTATTRCVPFEAEPEEGFCVRCGRPSAYGKRVVFAKAY 477
2 -134.0005f9y_A mol:protein length:511 Aminoacyl-tRNA synthetase  ali model follow..  41  6NESLLGITAKITSFADWYSQVIVKSEMIEYYDISGCYILRPWSYFIWETIQSVFDQKIKQHDVQNAYFPIFVTQKKLETEKDHVEGFSPEVAWVTKSGKSDLAEPIAIRPTSETIMYPYFAKWIRSHRDLPLKINQWTSIVRWEFKHPPFIRTREFLWQEGHTAHSTRKEALEMVDIILNEYASIYEDLLATPVVKGTKSENEKFPGGDITKSIEGFIPEGRAVQAATSHLLGQNFSKMFGVEFEDEKGNKEYAHQTSWGLTTRAIGVMIMTHGDNKGLVLPPKVAPVQVIIIPIIKTVITEEQKKICNEVECILKKAGVRVKIDDRSNYTPGWKYNHWEVKGVCLRFEVGPRDIEKRSVRVVVRDNMEKDIPISELESKIPKLLEEFQNRLLFKAKQRQNESIIRVDTFDKVMDTLNQKMVIAPWCEDVSCEEEIKKETAMKSLCIPNDQIEGKTKCFFCDKLAK--KFTLFGRSY 505
3 -133.0004ncx_A mol:protein length:506 Proline--tRNA ligase  ali model follow..  42  2ASNILGITSKKENFSDWYTQVIVKSELIEYYDISGCYILRPAAYYIWECVQAFFNKEIKKLNVENSYFPLFVTKNKLEKEKNHIEGFSPEVAWVTKYGDSNLPEEIAIRPTSETIMYSVFPKWIRSYRDLPLKLNQWNTVVRWEFKQPPFIRTREFLWQEGHTAHKNEEEAVKLVFDILDLYRRWYEEYLAVPIIKGIKSEGEKFGGANFTSTAEAISENGRAIQAATSHYLGTNFAKMFKIEFEDENEVKQYVHQTSWGCTTRSIGIMIMTHGDDKGLVLPPNVSKYKVVIVPIFKTTDENAIHSYCKDIEKILKNAQINCVYDDRASYSPGYKFNHWELRGIPIRIEVGPKDLQNNSCVIVRRDNNEKNVKKESVLLETQQMLVDIHKNLFLKAKKKLDDSIVQVTSFSEVMNALNKKMVLAPWCEDIATEEEIKKETAMKPLCIPLDQPPPNMKCFWSGKPAK--RWCLFGRSY 500
4 -131.0005xif_A mol:protein length:500 Prolyl-tRNA synthetase (ProRS)  ali model follow..  45  5......TAKKDENFSEWYTQAIVRSEMIEYYDISGCYIMRPWAFHIWEKVQRFFDDEIKKMGVENSYFPMFVSRHKLEKEKDHVEGFSPEVAWVTHYGDSPLPEKIAIRPTSETIMYPAYAKWIRSHRDLPLKLNQWCSVVRWEFKQPPFLRTREFLWQEGHTAHATEEEAWELVLDILELYRRWYEECLAVPVIKGEKSEGEKFAGGKKTTTVEAFIPENRGIQAATSHLLGTNFAKMFEIEFEDEEGHKRLVHQTSWGCTTRSLGVMIMTHGDDKGLVIPPRVASVQVVIIPILKDENTGEILGKCRELKTMLEKADIRVRIDDRSNYTPGWKYNHWEVKGVPLRLELGPKDLAKGTARVVRRDTGEAQISWADLAPKLLELMEGIQRSLFEKAKARLHEGIEKISTFDEVMPALNRKLVLAPWCEDPESEEQIKKETAMKTLCIPFDQPPEGTKCFYTGKPAK--RWTLWGRSY 500
5 -130.0005xip_A mol:protein length:498 Prolyl-tRNA synthetase, putative  ali model follow..  44  1.GAMGVTAKKSTNFADWYTQVIVRGELVEYYDISGCYIIRPWAYRIWEAVQKFFDDGIKRLGVENCYFPMFVSQAKLEKEKDHVEGFKPEVAWVTHYGDSELPEKVAIRPTSETIMYPAYAKWIRSHRDLPLKLNQWNNVVRWEFKQPPFLRTREFLWQEGHTAHATEEEAYTLVLEILELYRQWYEDYLAVPVIKGEKSENEKFAGGKKTTTIEGIIPDGRGIQAATSHLLGQNFSRMFSIEFEDEKGAKQLVHQTSWGCTTRSLGVMIMTHGDDKGLVLPPRVVAVQAVIIPIIKETGGMEIVAKCRELERLLNAAGVRVKVDDRTNYTPGWKFNDWELKGVPLRLEIGPRDVESCQTRVVRRDTSEANVPWAEAASTIPAMLETMQKDLFNKAKAKFEASIEQITTFDEVMPALNRRVVLAPWCEDPETETQIKRETAMKPLCIPFDQPPEGTRCFFTGRPAK--RWCLFGRSY 498
6 -128.0004hvc_A mol:protein length:519 Bifunctional glutamate/proline--tRNA ligase  ali model follow..  43  11KQTRLGLEAKEENLADWYSQVITKSEMIEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPPFLRTREFLWQEGHSAFATMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNAKEALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKTVAENEAETKLQAILEDIQVTLFTRASEDLKTHMVVANTMEDFQKILDSGIVQIPFCGEIDCEDWIKKTTGAKSLCIPFKPLQPGAKCVCGKNPAK--YYTLFGRSY 513
7 -127.0004k86_A mol:protein length:535 Proline--tRNA ligase  ali model follow..  41  28QTRLGLEAKKEENLADWYSQVITKSEMIEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQS-ALEKEKTHVADFAPEVWVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPPFLRTREFLWQEGHSAFATMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNAKEALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKTVAENEAETKLQAILEDIQVTLFTRASEDLKTHMVVANTMEDFQKILDSGIVQIPFCGEIDCEDWIKKTTGAKSLCIPFKPLQPGAKCVCGKNPAK--YYTLFGRSY 529
8 -127.0005xil_A mol:protein length:512 Putative prolyl-tRNA synthetase  ali model follow..  42  1.GAMGIAAKREENFSAWYIDVITKAEMIEYYDVSGCYIIRPWAYYVWKCVQRFLGGKIEKLGVEDCYFPMFVSRSCLEREKDHIEGFAPEVAWVTRAGDTELEQPVAVRPTSETVMYPYYAKWIRSHRDLPVRLNMWNNVIRWEFSPTPFIRTREFLWQEGHCAWAKAEECAKEVLEILECYASVYEQLLAVPVVRGRKTEKEKFAGGDYTTTVETFIEAGRGCQGATSHNLGQNFGKMFDIRFQDPENNEQIPWQNSWGLSTRVIGVMIMVHGDNRGMVMPPRVASTQVIIIPVGITKDTQELLASCWRLESELCEGGVRARCDLRDNYSPGWRFNHWEVKGVPLRVELGPRELAERSLAVAVRHSGARSVAWDAQTPAAAALLEDVHAQMYARAKETMETHRVRVTEWTEFVPTLNRKLILAPWCGAMECENQVKKDSGAKTLCIPFEQPEHECICKGCTKPAT--TWVLFGRSY 512
9 -125.0003ial_A mol:protein length:518 Prolyl-tRNA synthetase  ali model follow..  31  11......LTKTRDTFADWFDAIMDAAELVDRRPVKGCVVFRPYGFFMENAIMRLCEEEYAKVGISQILFPTVIPESFLKKESDHIKGFEAECFWVEKGGLQPLEERLALRPTSETAIYSMFSKWVRSYKDLPLKIHQTCTIFRHETKNTPLIRVREIHWNEAHCCHATAEDAVSQLSDYWKVIDTIFSDELCFKGQKLRRVCWDRFPGADYSEVSDVVMPCGRVLQTAGIHNLGQRFSSTFDILYANKANESVHPYLTCAGISTRVLACALSIHGDSGGLVLPPLIAPIHVVIIPIGCGKKNQQVLGKVNEIADTLSKLGLRVSIDDDFSKSMGDKLYYYELKGVPLRIEVGQRDLANGQCIVVPRDVGKDQIPITEVMKVSSDELDAYKARLKEKAFAFHNSMVTNCKSFDEIVACIENGLARFPFYTTEADGEVWDKACSAEIRGHNPDENVPGEVCALSGKPAV--CYMYCAKSY 512
10 -125.0001nj1_A mol:protein length:501 Proline-tRNA Synthetase  ali model follow..  38  19IKKDPNRYHKMTEFSEWFHNILEEAEIIDQRPVKGMHVWMPHGFMIRKNTLKILRRILDR-DHEEVLFPLLVPEDELAKEAIHVKGFEDEVYWVTHGGLSKLQRKLALRPTSETVMYPMFALWVRSHTDLPMRFYQVVNTFRYETKHTLIRVREITTFKEAHTIHATASEAEEQVERAVEIYKEFFNSLGI-PYLITRRPPWDKFPGSEYTVAFDTLMPDGKTLQIGTVHNLGQTFARTFEIKFETPEGDHEYVHQTCYGLSDRVIASVIAIHGDESGLCLPPDVAAHQVVIVPIIFKKAAEEVMEACRELRSRLEAAGFRVHLDDR-DIRAGRKYYEWEMRGVPLRVEIGPRDLEKGAAVISRRDTGEKTADLQGIEETLRELMKDILENLRTRAWERMESEIREAETLEEASRIVDRGIISFMWCGEEECGMDVEEKVRVDILGIQEEGS---GTCINCGREAP--YRAYLARTY 495
11 -110.0001nj8_A mol:protein length:459 Proline-tRNA Synthetase  ali model follow..  36  1.......GSHMLEFSEWYSDILEKAEIYDRYPIKGCGVYLPYGFKIRRYTFEIIRNLLDESGHDEALFPMLIPEDLLAKEAEHIKGFEDEVYWVTHGGKTQLDVKLALRPTSETPIYYMMKLWVKVHTDLPIKIYQIVNTFRYETKHTPLIRLREIMFKEAHTAHSTKEEAENQVKEAISIYKKFFDTLGI-PYLISKRPEWDKFPGAEYTMAFDTIFPDGRTMQIATVHNLGQNFSKTFEIIFETPTGDKDYAYQTCYGISDRVIASIIAIHGDEKGLILPPIVAPIQVVIVPLIFKGKEDIVMEKAKEIYEKL-KGKFRVHIDDR-DIRPGRKFNDWEIKGVPLRIEVGPKDIENKKITLFRRDTMEKQVDETQLMEVVEKTLNNIMENIKNRAWEKFENFITILEDIDEIKNILSEGVILVPFKEEIYNEELEEK-VEATILGET---EYKGNKYIAIA------------KTY 459
12 -79.4002j3l_A mol:protein length:572 PROLYL-TRNA SYNTHETASE  ali model follow..  20  3QSKMLIPTLRENDAEVLSHQILLRAGYI-RQVAAGIYSYLPLANRVLEKLKTIMREEFEKIDAVEMLMPALLPAE-LWKESGRYETYGPNLYRLKDRN----DRDYILGPTHEETFTELIRDEINSYKRLPLNLYQIQTKYRDEKRSRGLLRGREFIMKDGYSFHADEASLDQSYRDYEKAYSRIFERCGLEFRAIIGDGGAMGGKDSKESPDGNGVLAFTKGIEIGHIFKLGTRYSDAMGATVLDENGREKSVIMGCYGIVSRLLSAIVEQNADERGINWPTGIAPFDLHVVQM--NVKDEYQTKLSQEVEAMMTEAGYEVLVDDR-NERAGVKFADADLIGCPIRITVGKKAVD-GVVEVKIKRTGEMLVRKEELESTLSILMNTTSEV...................................................................................... 571
13 -78.4002i4l_A mol:protein length:458 Proline-tRNA ligase  ali model follow..  21  17LSRFFLPILKEKEAEIVSHRLMLRAGML-RQEAAGIYAWLPLGHRVLKKIEQIVREEQNRAGAIELLMPTLQLAD-LWRESGRYDAYGPEMLRIA----DRHKRELLYGPTNEEMITEIFRAYIKSYKSLPLNLYHIQWKFRDEQRPRGVMRGREFLMKDAYSFDVDEAGARKSYNKMFVAYLRTFARMGLKAIPMRAETGPIGGDLSHESEVPEANRLNTRGIEVGQIFYFGTKYSDSMKANVTGPDGTDAPIHGGSYGVVSRLLGAIIEACHDDNGIIWPEAVAPFRVTILNL--KQGDAATDAACDQLYRELSAKGVDVLYDDT-DQRAGAKFATADLIGIPWQIHVGPRGLAEGKVELKRRSDGARNLALADVVARLT............................................................................................... 452
14 -72.3005ucm_A mol:protein length:579 Proline--tRNA ligase  ali model follow..  21  5TSQYLLSTLKEADAVVISHQLLLRAGMI-RRLASGLYTWLPMGLRVLRKVETIVREEMNAAGALEVLMPAVQPAE-LWQESGRWEQYGPELLRLKDRH----EREFCVGPTHEEVITDLARNELNSYKQLPINFYQIQTKFRDEIRPRGLMRGREFIMKDAYSFHLSQDSLQQTYDGMYQAYSKIFSRLGLDFRPVQADNGSIGGSGSHESPDGKGTLVIKRGIEVGHIFQLGTKYSEAMKLSVLSEQGKPVNLIMGCYGIVSRVVAAAIEQNHDERGILWPSALAPFQIALVPL--KYETESVKQATDKLYAELTAAGFEVLLDDRDKKSPGVKFADMELIGIPHRIVISDRGLSEGVLEYKGRRDSESQLPIGELMSFITEKLSR.......................................................................................... 573
15 -70.0004p3n_A mol:protein length:415 Threonine--tRNA ligase, cytoplasmic  ali model follow..  20  1.....................MGSSSSGDHRKIPGSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSR-LWMTSGHWQHYSENMFSF-----EVEKELFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSLTGLTRVRRFQQDDAHIFC-AMEQIEDEIKGCLDFLRTVYSVFGFSFKLFGEKWELNSGDGAFYGPKIDIQIKDAIGRYQCATIQLDFQLPIRFNLTYVSHDGDDKIVHRAILGSVERMIAILT----ENYGGKWPFWLSPRQVMVVPVG-----PTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVGERTISETIERLQQLKEFRSKQAEEE.................................................................................. 408
16 -68.3003a31_A mol:protein length:471 Probable threonyl-tRNA synthetase 1  ali model follow..  15  1......MASGQDKTHIDYAYELDITVKPDSRVPAGVPLFSLGGGPIRYALAEVLAKFHARRGYYVVETPIIASTE-LFKVSGHIEFYRNNMYLF-----DIEGHEFAVKPMNCPYHILLFLNEVASKLPLPFKVFEFGRVHRYEPSIYGLLRVRGFTQDDAHIIV-PGGRVIDVVYDVFEEMKLVLERLFKL-EKYGIDIVELEGEAAFYGPKLDFIMSGVSKEWQMGTIQFDFNLPRRFRLYDVVREEEVYIIHRALLGSIERFLGVYL----EHRRGRMPFTLAPIQFAVIAVKTGGEVREIEDLASSIAKGLLDKGFRVAVKGSSKTGLSSDVRHIESTAKPAVVFIGAKEVREKVLDVRVFDLESKRRRLAIAYGDAADAVENLAAVAEELESPVRSLSGQAPRIPADFSFML............................................................ 471
17 -67.7004hwt_A mol:protein length:413 Threonine--tRNA ligase, cytoplasmic  ali model follow..  20  2..........................ARDHRKIPGSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSR-LWMTSGHWQHYSENMFSF-----EVEKELFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSLTGLTRVRRFQQDDAHIFC-AMEQIEDEIKGCLDFLRTVYSVFGFSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYQCATIQLDFQLPIRFNLTYVSHDGDDKIVHRAILGSVERMIAILT----ENYGGKWPFWLSPRQVMVVPVG-----PTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVGERTISETIERLQQLKEFRSKQAEEEFLE............................................................................... 407
18 -64.9001nyq_A mol:protein length:645 threonyl-tRNA synthetase 1  ali model follow..  18  214LQRIYGTAFFDKKELKAHLQMLEERKERDHRKIAGLPLWLPNGATIRREIERYIVDKEVSMGYDHVYTPVLANVD-LYKTSGHWDHYQEDMFPPM---QLDETESMVLRPMNCPHHMMIYANKPHSYRELPIRIAELGTMHRYEASVSGLQRVRGMTLNDSHIFV-RPDQIKEEFKRVVNMIIDVYKDFGFAADELGLSYEEAIGEAAFYGPKLDVQVKTAMGKETLSTAQLDFLLPERFDLTYIGQDGEHHVIHRGVVSTMERFVAFLT----EETKGAFPTWLAPKQVQIIPVN----VDLHYDYARQLQDELKSQGVRVSIDD-RNEKMGYKIREAQMQKIPYQIVVGDKEVENNQVNVRQYGSQDETVEKDEFIWNLVDEIRLKKHR...................................................................................... 645
19 -62.6003ugq_A mol:protein length:460 Threonyl-tRNA synthetase, mitochondrial  ali model follow..  18  9VPRGSHMASATKNA-------SSATPATMTSMVPGSMFFLPNGAKIFNKLIEFMKLQQKKFGFNEVVTPLIYKKT-LWEKSGHWENYADDMFKVETT--DEEKEEYGLKPMNCPGHCLIFGKKDRSYNELPLRFSDFSPLHRNEASLSGLTRLRKFHQDDGHIFC-TPSQVKSEIFNSLKLIDIVYNKIFPILEESGKPWKLNPGDGAFYGPKLDIMVTDHLRKTQVATIQLDFQLPERFDLKFKDQDNSYKMIHRATFGSIERFMALLI----DSNEGRWPFWLNPYQAVIIPVNTKNVQRNELEADDMEPVPLNDWHFNVDLDI-RNEPVGYRIKSAILKNYSYLIIVGDEEVQLQKYNIRERDNRKSKLTMSQIWEKFIELEKNYK........................................................................................ 454
20 -62.2004hwo_A mol:protein length:411 Threonine--tRNA ligase  ali model follow..  20  2..........................ARDHRKIPGMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRV-LWEKTGHWDNYKDAMFTT-----SSENREYCIKPMNCPGHVQIFNQGLKSYRDLPLRMAEFGSCHRNEPSLHGLMRVRGFTQDDAHIFC-TEEQIRDEVNGCIRLVYDMYSTFGFALEENNIPFEYQLGEGAFYGPKIEFTLYDCLDRAQCGTVQLDFSLPSRLSASYVGEDNERKMIHRAILGSMERFIGILT----EEFAGFFPTWLAPVQVVIMNIT-----DSQSEYVNELTQKLSNAGIRVKADLR-NEKIGFKIREHTLRRVPYMLVCGDKEVESGKVAVRTRRGKDGSMDVNEVIEKLQQEIRSRSLKQLEE.................................................................................. 403
21 -60.2001qf6_A mol:protein length:642 THREONYL-TRNA SYNTHETASE  ali model follow..  19  215LQRIYGTAWADKKALNAYLQRLEEAAKRDHRKIPGMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRV-LWEKTGHWDNYKDAMFTT-----SSENREYCIKPMNCPGHVQIFNQGLKSYRDLPLRMAEFGSCHRNEPSLHGLMRVRGFTQDDAHIFC-TEEQIRDEVNGCIRLVYDMYSTFGFALEENNIPFEYQLGEGAFYGPKIEFTLYDCLDRAQCGTVQLDFSLPSRLSASYVGEDNERKMIHRAILGSMERFIGILT----EEFAGFFPTWLAPVQVVIMNIT-----DSQSEYVNELTQKLSNAGIRVKADLR-NEKIGFKIREHTLRRVPYMLVCGDKEVESGKVAVRTRRGKDGSMDVNEVIEKLQQEIRSRSLKQLEE.................................................................................. 642
22 -45.2001b76_A mol:protein length:442 Glycine--tRNA ligase  ali model follow..  17  1..........AASSLDELVALCKRRGFI-YGGLQGVYDYGPLGVELKNNLKQAWWRRNERDDMEGLDASVLTHRL-VLHYSGHEATFADPMVDNAKARYGGRGLLAYLRPETAQGIFVNFKNVLDATSKLGFGIAQIGKAFRNEITPNFIFRVREFEQMEIEYF-VRPGEDEYWHRYWVEERLKWWQEMGLSRENLVPYQQPPESSAHYAKATVDILYRELEGIAQRTDFDLGSHTKDQEALGITARVLRNEYVIEPSAGVDRGVLALLAEAFTREE-LKLKPQLAPIKVAVIPLV--KNRPEITEYAKRLKARLLALGLGRVLYEDTG-NIGKAYRRHDEVGTPFAVTVDYDTIGQSTVTVRDRDTMEQRLHVDELEGFLRERLR........................................................................................... 441
23 -36.8002cim_A mol:protein length:522 SERYL-TRNA SYNTHETASE  ali model follow..  15  191.........MEHPFKEDPTQAMMKEGWLKRGSSRGQWIHGPQSARIFRTFEKIVLEELEPLGYREMIFPKLVTWEVW-MKSGHAKGVYPEIYYVCPPQTRDPDYIGGMCYAQCPPFWMYVAGETLPNEEIPVKVFDRGTSHRYESGIHGIERVDEFHRIEIVWI-GTKEEVLKCAEELHDRYMHIFNDILDIEWRKARLAEENTVGTTDYEACLPYRGPDGEWLEFQNVSINGDKYPKGFNVKLQSGD----ELWSGCSGVLERWAAVFLAQKGLDPA-NWP---EEFRNRVGEMPKGIR................................................................................................................................................................................. 514
24 -36.8001ati_A mol:protein length:505 GLYCYL-TRNA SYNTHETASE  ali model follow..  17  1..........AASSLDELVALCKRRGFI-YGGLQGVYDYGPLGVELKNNLKQAWWRRNERDDMEGLDASVLTHRL-VLHYSGHEATFADPMVDNRITKKGGRGLLAYLRPETAQGIFVNFKNVLDATSRLGFGIAQIGKAFRNEITPNFIFRVREFEQMEIEYFV-RPGEDEYWHRYWVEERLKWWQEMGLSRENLVPYQQPPESSAHYAKATVDILYRELEGIAQRTDFDLGSHTKDQEALGITARVLRNEYVIEPSAGVDRGVLALLAEAFTREE-LKLKPQLAPIKVAVIPLVK--NRPEITEYAKRLKARLLALGLGRVLYEDTG-NIGKAYRRHDEVGTPFAVTVDYDTIGQSTVTVRDRDTMEQILHVDELEGFLRERLR........................................................................................... 504
25 -32.9002pme_A mol:protein length:693 Glycyl-tRNA synthetase  ali model follow..  16  60.......PKDDIVDRAKMEDTLKRRFFY-YGGVSGLYDFGPVGCALKNNIIQTWRQHFQEEQILEIDCTMLTPEP-VLKTSGHVDKFADFMVKDVKNGEGGNMPGYLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRGLIRVREFTMAEIEHFVDPSEKDHPKFQNVADLHLYLYTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYGIETEGKTFQLTKDMINVKRFQKTLYVEEVVPNVISFGL-GRIMYTVFEHTFHVREFSFPAVVAPFKCSVLPLS---QNQEFMPFVKELSEALTRHGVSHKVDDSSG-SIGRRYARTDEIGVAFGVTIDFDTVNKTTATLRDRDSMRQIAEISELPSIVQDLANG--ADVEARYPLFEGQETGKKETIEELE............................................................... 687
26 -31.7003qne_A mol:protein length:485 Seryl-tRNA synthetase, cytoplasmic  ali model follow..  12  127LVRTWTPENYKKPEQLSHHEVLLRLDGYDPERGHRGYFLRNYGVFLNQALINYGLSFLSSKGYVPLQAPVMMNKE-VMAKTAQLSQFDEELYKVI----DGEDEKYLIATSEQPISAYHAGEWFSPAEQLPVRYAGYSSCFRREADAWGIFRVHAFEKIEQFVL-TEPEKSWEEFDRMIGCSEEFYQSLGLPYRVVGIVSGELNNAAAKKYDLEAWFPFQQEYKELVSCSNCTDYQSRNLEIRCGIKQQNQQHCLNSTLSATERTICCILENYQKEDGLVIPEVLRKY----------PGEPEFIPYIKELPKNTTSVKKAKGKNPK-NTTSVKKAKGKNGSR...................................................................................................................................... 479
27 -28.7004h2w_A mol:protein length:346 Amino acid--[acyl-carrier-protein] ligase 1  ali model follow..  15  17.IAVLPNSPDTAPQIADPLDHLADKLFH-SMGSDGVYARTALYESIVERLAALITS-HREAGTEALRFPPVMSRAQL-EKSGYLKSFPNLLGCVCGLHGTEREADLVLSPAACYPVYPIAASRGPL-PKGGLRFDVAADCFRREPS-KHLDRLQSFRMRE-YVCIGTPDDVSDFRERWMVRAQAIARDLGLTFRVDGRAGKMLANNQRDQQLKFELLIPEEQPTACMSFNYHREHFGTTWGIQDANGE----PAHTGCVAFMDRLAVAMFHTHGTDLS-AWPAKVRDI............................................................................................................................................................................................. 323
28 -28.5003mey_A mol:protein length:346 Bll0957 protein  ali model follow..  15  17.IAVLPNSPDTAPQIADPLDHLADKLFHS-MGSDGVYARTALYESIVERLAALITS-HREAGTEALRFPPVMSRAQL-EKSGYLKSFPNLLGCVCGLHGTEREADLVLSPAACYPVYPIAASRGPL-PKGGLRFDVAADCFRREPS-KHLDRLQSFRMREY-VCIGTPDDVSDFRERWMVRAQAIARDLGLTFRVDGRVGQMKAVSQKQQQLKFELLISEEQPTACMSFNYHREHFGTTWGIQDANGE----PAHTGCVAFMDRLAVAMFHTHGTDLS-AWPAKVRDI............................................................................................................................................................................................. 323
29 -27.0005c51_B mol:protein length:485 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  15  59.......APGSGEGSEALLEICQRRHFL-SLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPV-LHHKPGPLLPGDSAFRLVSAETLQLVAFLENVLKTSGKLRENLLHGALEHYVNCLDLVNRLPYGLAQIGVCFHPVFDTNGVKSIGEKTEASLVWF-TPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNF--ELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCSVNGDLDRGMLAYLYDSFQLTENLKLHPCLAPIKVALDVG--RGPTLELRQVCQGLFNELLENGISVGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTKEMMHISKLKDFLIKYISSAKN....................................................................................... 484
30 -26.7002g4c_A mol:protein length:474 DNA polymerase gamma subunit 2  ali model follow..  15  42.......APGSGEGSEALLEICQRRHFL-SLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPV-LHHKPGPLLPGDSAFRLVSAETLQLVTFLENVLKTSGKLRENLLHGALEHYVNCLDLVNRLPYGLAQIGVCFHPVFDTKGVKSIGEKTEASLVWF-TPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNF--ELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCSVNGDLDRGMLAYLYDSFQLTENLKLHPCLAPIKVALDVGR--GPTLELRQVCQGLFNELLENGISVGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTKEMMHISKLKDFLIKYISSAKN....................................................................................... 467
31 -26.1004ztu_B mol:protein length:472 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  15  29.NGEHPEAPGSGEGSEALLEICQRRHFL-SLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPV-LHHKPGPLLPGDSAFRLVSAETLQLVAFLENVLKTSGKLRENLLHGALEHYVNCLDLVNRLPYGLAQIGVCFHPVFDTKGVKSIGEKTEASLVWF-TPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNF--ELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCSVNGDLDRGMLAYLYDSFQLTENLKLHPCLAPIKVALDVG--RGPTLELRQVCQGLFNELLENGISVGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTKEMMHISKLKDFLIKYISSAKN....................................................................................... 460
32 -25.0001g5h_A mol:protein length:454 MITOCHONDRIAL DNA POLYMERASE ACCESSORY SUBUNIT  ali model follow..  14  17.......APEHAVAREALVDLCRRRHFL-AALLSGCHAFGPLGVELRKNLASQWWSSMVVFREQVFAVDSLHQEPSSQPRDSAFRLVSPESEQLVAFLENLLKTSGKLRATLLHGALEHYVNCLDLVNKLPFGLAQIGVCFHPVSNSSSVTRVGEKTEASLVWF-TPTRTSSQWLDFWLRHRLLWWRKFAMSPSNFSSADCQDELGRKGSKLYYSF--EPIETLWNLGDQELLHTYPGNVSTIQGRDGRKNVVPCSVSGDVDLGTLAYLYDSFQLAENLKLHPCLAPIKVALDVG--KGPTVELRQVCQGLLNELLENGISVGYSETVHSSLEQLHSKYDEMSVLFSVLVTETTLENGLIQLRSRDTTKEMMHISKLRDFLVKYLASASN....................................................................................... 442
33 -23.0003ikl_A mol:protein length:459 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  13  78.................FLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKP-------------------GPLLPGDSAFRGGLRENLLHGALEHYVNCLDLVNRLPYGLAQIGVCFHPVFDTK-VKSIGEKTEASLVWF-TPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNF--ELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCSVNGDLDRGMLAYLYDSFQLTENLKLHPCLAPIKVALDVG--RGPTLELRQVCQGLFNELLENGISVWPGETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTKEMMHISKLKDFLIKYISSAKN....................................................................................... 452
34 -22.9003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  16  4..........GTLEAQTQGPGSMQKNMVETEPVQGCRDFPPEAMRCRRHLFDVFHATAKTFGFEEYDAPVLESEELYIRKAG--EEITEQMFNFITKG----GHRVALRPEMTPSLARLLLGKGRSLL-LPAKWYSIPQCWRYEAITRG--RRREHYQWNMDIVGVKSVSAEVE---LVCAACWAMRSLGLSSKDVGIKVNSRKGEEHEAVKELRQFFEQVEAYGYGDWVLFDASVVRGLAIVFEGFDREGKFRALCGGGRYDNLLTTYIPCAGFGFGDLLPDIPHVVDDVVIPF-----DESMRPHALAVLRRLRDAGRSADII--DKKKVVQAFNYADRVGAVRAVLVAPEEWERGEVQVKMREGTGKEEGGAERGFAVPL.............................................................................................. 446
35 -22.8003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  14  16......................MQMNMVETEPVQGCRDFPPETMRLRKYLFDVFHSTARKFGFEEYDSPVLESEELYIRKAG--EEITEQMFNFITKG----GHRVALRPEMTPSLARQLLAKGRSLL-LPAKWYSIPQCWRYEAITRG--RRREHYQWNMDIIGVKSVSSEVE---LVCAACTAMQSLGLSSKDVGVKINSRK-EEHEAVRELRDFITQIEAYGFGDWVIFDASVVRGLAYNLLTTYGSPTAVPCVGFGFGDCVIVELLNEKK-----LLPELHHVVDDLVIPF-----DETMRPHALSILRRLRDAGRSADIV--DKKKVVQAFNYADRIGALRAVLVAPDEWARGEVRVKMREGAGREEGANERGIVLPV.............................................................................................. 446
36 -22.3001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  14  2.........................YRLQIEKIRGFRDFYPEDMDVEKFIFKTAEEAAEAFGFRRIDFPSLEYLDLYRIKSG--EELLQQTYSFVDKG----GREVTLIPEATPSTVRMVTS--RKDLQRPLRWYSFPKVWRYEEPQAG--RYREHYQFNADIFGSDSPEADAEVIALLGLQDIYEIRINSRKIMEEIIGGMTSSDPFSVFSIIDRYVEDLLASYGVKNVRYDFSIVRGLSIVFEAYDRSGQFRAILGGGRYDNLASLMISLLLKRENVQIPREKKSVYICRV-------GKINSSIMNEYSRKLRERGMNVTVE--MERGLSAQLKYASAIGADFAVIFGERDLERGVVTIRNYTGSQENVGLDSVVEHLISQATL.......................................................................................... 427
37 -22.2003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  12  1..................SNAMAKNDKINFSTPSGFPEFLPSEKRLELYLLDTIRRVYESYGFTPIETPAVERLEVLQAKGNQGDNIQAEKDKSGDTG----SEARALKFDQTVPLAAYIARHLNDLT-FPFARYQMDVVFRGERAKDG--RFRQFRQCDIDVVGREKLSLLYDAQ-MPAIITEIFEAVNIGDFVIRINNRVSELETVITGVRNLGVPDKRFCIDLAIARGLNYYTGTVYETTLIGHEALGSICSGGRYEELVGTFIG-LISRLLKAGILNTLPPTPAQVVVVNM-----QDELMPTYLKVSQQLRQAGLNVITN--EKRQLGKQFQAADKQGIRFCVIIGADEAAAQKSSLKDLQSGEQEVALADLAEEIKRRLT........................................................................................... 465
38 -22.1001qe0_A mol:protein length:420 Histidine--tRNA ligase  ali model follow..  14  3..............................KIPRGTQDILPEDSKKWRYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGD-DVVQKEMYTFKDKG----DRSITLRPEGTAAVVRSYEHKMQGNPNQPIKLYYNGPMFRYERKQKG--RYRQFNQFGVEAIGAENPSVDAE---VLAMVMHIYQSFGLKHLKLVINSVGDMASRKEYNEALVKHFEPVIHEDPNLVRGLDYYTHTAFELMMDNPNYDGAITTLCGGGRYNGLLELLDGPSETGIGFALLDIEENLDLFIVTMG-----DQADRYAVKLLNHLRHNGIKADKD--LQRKIKGQMKQADRLGAKFTIVIGDQELENNKIDVKNMTTGESTIELDALVEYFKK.............................................................................................. 420
39 -22.1001v95_A mol:protein length:130 Nuclear receptor coactivator 5  ali model follow..  7.............................................................................................................................................................................................................................................................................................GPVDCSVIVV-----NKQTKDYAESVGRKVRDLGMVVDLI-NTEVSLSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQEHRNMPQADAMVLVARNYERYKNECREK............................................................................... 115
40 -21.8004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  13  60......................ESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGE----SKLIYDLKDQG----GELLSLRY-----LTVPFARYLAMNKLTNIKRYHIAKVYRRDNPAMTRGRYREFYQCDFDIAGNFDPMIPDA--ECLKIMCEILSSLQIGDFLVKVNDRSQNKQALEGLGDLKLLFEYLTLFGIDDKISFDLSLARGLDTPAQAGEEPLGVGSVAAGGRYDGLVGMFDPKGRKVPCVGLSIGVERIFSIVTQVLVASAQKKLLEERLKLVSELWDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSTSREEVDVRREDLVEEIKRRTGQ.......................................................................................... 515
41 -21.8005e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  14  2.........................AMSSIVAIKGFNDVLPTQTAAWRRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRAIGD-DIVEKEMYTFFDKGNP--PESLTLRPEGTAGCVRALVEH-NLLRGATPRVWYMGPMFRYEKPQKG--RYRQFHQFGVETFGVATPDIDAE---LIMLTARLWKRMGVDHMVQDERTEYRNALVAFLNEHKDALDEDSQRRLTTNPLRLDYYNKTVFEWTTTALGSQGTVCAGGRYDGLVGQLKGKADQSVPAVGFAM----VRDCEAFLVAE-----PAYQSKALVLAEQLRDQLEAANSNTGSQGSMKSQMKKADQAGAVYAIILGEREWEAQQLAVKEATAEQSQVALAELVPFLIEKFTK.......................................................................................... 432
42 -21.7004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  13  7......................ELRRQFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGE----SKLIYDLKDQG----GELLSLRY-----LTVPFARYLAMNKLTNIKRYHIAKVYRRDNPAMTRGRYREFYQCDFDIAGNFDPMIPDA--ECLKIMCEILSSLQIGDFLVKVNDRSQNKQALEGLGDLKLLFEYLTLFGIDDKISFDLSLARGLDTPAQAGEEPLGVGSVAAGGRYDGLVGMFDPKGRKVPCVGLSIGVERIFSIVTQVLVASAQKKLLEERLKLVSELWDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSTSREEVDVRREDLVEEIKRRTGQ.......................................................................................... 462
43 -21.4004rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  15  1.........................GPMTARAVRGTKDLFGKELRMHQRIVATARKVLEAAGALELVTPIFEETQVFEKGVGA-DIVRKEMFTFQDRG----GRSLTLRPEGTAAMVRAYLEHGMKVWPQPVRLWMAGPMFRAERPQKG--RYRQFHQVNYEALGSENPILDAE---AVVLLYECLKELGLRRLKVKLSSVGDPEDRARYNAYLREVLSPHRELEPALVRGLDYYVRTAFEVHHEEIGAQSALGGGGRYDGLSELLGRVALALEAEG--FGLPEEKGPDLYLIPLT-----EEAVAEAFYLAEALRP-RLRAEYA--APRKPAKGLEEALKRGAAFAGFLGEDELRAGEVTLKRLATGEQRLSREEVPGYLLQALG........................................................................................... 423
44 -21.1003vbb_A mol:protein length:522 Seryl-tRNA synthetase, cytoplasmic  ali model follow..  15  170.................HVDLVVMVDGFEGEVVAGSYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEVM-QEVAQLSQFDEELYKVIGKGSEKSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQEVDTRGIFRVHQFEKIEQFVYSSPHNKSWEMFEEMITTAEEFYQSLGIPYHIVNIVSG-SLNHAASKKLDLEAWFPGSGA-ELVSCSNCTDYQARRLRIRYGQTKKMMDHMLNATMCATTRTICAILENYQTEKGITVPEKLKEFLQELIPFVKPAPIEQEPSKKQKKQHEGSKKKAAARDVTLENRLQNMEVTDA.......................................................................................................................................... 514
45 -21.0004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  16  3MGTLEAQTQGPGSMTE------QKRKLEKLTGVKGMNDILPQDAGLWEFFEATVKSLLRAYGYQNIRTPIVEHTPLFTRGIGE-DIVEKEMYSFVDALN---GENLTLRPENTAAVVRAAIEH-NMLYDGPKRLWYIGPMFRHERPQRG--RYRQFHQVGVEALGFAGPDADAE---IVMMCQRLWEDLGLTGIKLEINSLGLAEERAAHRVELIKYLEQHADINPRLVRGLDYYNLTVFEWVTDKLGAQGTVAAGGRYDPLIEQLGG-ILELLKEEHLV--PEQEGVDVYVVHQG-----DAAREQAFIVAERLRDTGLDVILADGAGASFKSQMKRADASGAAFAVIFGEDEVTNGTASVKPEKSVQQSVPVESLTEFLINAMVATAED...................................................................................... 458
46 -21.0005c53_B mol:protein length:903 Pol gamma B  ali model follow..  13  551......................................FGPLGVELRKNLAAEWWTSV---------------------VVFREQVFPVDALHHKPGPLLPGDSAFRLRENLLHGALEHYVNCLDLVNRLPYGLAQIGVCFHPVFDTKGVKSIGEKTEASLVWF-TPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNF--ELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVVLSVNGDLDRGMLAYLYDSFQLTENLKLHPCLAPIKVALDVG--RGPTLELRQVCQGLFNELLENGISVWPGETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTKEMMHISKLKDFLIKYISSAKN....................................................................................... 902
47 -20.9003w3s_A mol:protein length:527 Type-2 serine--tRNA ligase  ali model follow..  18  200.....................ARRRGWVKEFPGRGQWIYTPPMAALFEVLRDFLLERVRKLGFEPALFPKLIPLETM-FRMRYLHGLPDGMYYVCPPKRDPEDPGYVLAPAQCEPFYELLRDEVVDPERLPIKLYDCGWTYRWEGGAKGLERVNEFQRIE--VWIAEPEEAYRIRRELLEATKRVAEELELEWKVVVSDPDVPSYEFEVYLPFKGERSSEEAWISVGSFNVHGEHFVDGFNVK--EKSGRTLFTGCAGLGV-TRWVVGLLAQHGFYPY-EWPEPI................................................................................................................................................................................................ 505
48 -20.6001ser_A mol:protein length:421 PROTEIN (SERYL-TRNA SYNTHETASE (E.C.6.1.1.11))  ali model follow..  14  127.........PEFSFPPLDHVALMEKNGWWEPQVSGSYALKGDLALYELALLRFAMDFMARRGFLPMTLPSYAREKAF-LGTGHFPAYRDQVWAI-------AETDLYLTGTAEVVLNALHSGEILPYEALPLRYAGYAPAFRSEADVRGLMRVHQFHKVEQYVLTESLEASDRAFQELLENAEEILRLLELPYRLVEVATG-DMGPGKWRQVDIEVYLPSEGR-ETHSCSALLDWQARRANLRYRDPEGRVRYAYTNTALATPRILAMLLENHQLQDGVRVPQALIPY............................................................................................................................................................................................. 411
49 -20.3002dq3_A mol:protein length:425 Seryl-tRNA synthetase  ali model follow..  15  124EVRRWGEPRKFDFEPKPHWEIGERLGILDFKKLSGSTVIAGWGARLERALINFMLDLHTKKGYKEICPPHLVKPEIL-IGTGQLPKFEEDLYKCE-------RDNLYLIPTAEVPLTNLYREEILKEENLPIYLTAYTPCYRREADIRGIIRQHQFDKVELVKI-VHPDTSYDELEKLVKDAEEVLQLLGLPYRVVELCTG-DLGFSAAKTYDIEVWFPSQNK-EISSCSNCEDFQARRMNTRFKDSKTGKNRFVHTLNGAVGRTLAAILENYQQEDGVVVPEVLRDY............................................................................................................................................................................................. 416
50 -20.3003err_A mol:protein length:536 fusion protein of microtubule binding domain from mouse cytoplasmic dynein and seryl-tRNA synthetase from Thermus thermophilus  ali model follow..  15  228EIKRVGGPPEFSFPPLDHVALMEKNGWWEPRQVSGSYALKGDLALYELALLRFAMDFMARRGFLPMTLPSYAREKAF-LGTGHFPAYRDQVWAI-------AETDLYLTGTAEVVLNALHSGEILPYEALPLRYAGYAPAFRSEADVRGLMRVHQFHKVEQYVLTEASLESDRAFQELLENAEEILRLLELPYRLVEVATG-DMGPGKWRQVDIEVYLPSEGR-ETHSCSALLDWQARRANLRYRDPEGRVRYAYTNTALATPRILAMLLENHQLQDGVRVPQALIPY............................................................................................................................................................................................. 520
51 -20.2001wle_A mol:protein length:501 Seryl-tRNA synthetase  ali model follow..  17  167..HVVGDKPAFSFQPRGHLEIAEKLDIIRQKHVSGSYYLRGAGALLQHGLVNFTLNKLIHRGFTPMTVPDLLRGVVF-EGCGMTPNAKPSQIYNID---PSRFEDLNLAGTAEVGLAGYFMDHSVAFRDLPIRMVCSSTCYRAETDPWGLYRVHHFTKVEMFGVTGGLEQSSELLEEFLSLQMEILTELGLHFRVLDMPTQ-ELGLPAYRKFDIEAWMPGRGR-EVTSASNCTDFQSRRLHIMFQTEAGELQFAHTATGCAVPRLLIALLESYQQKDGVLVPPALQPY............................................................................................................................................................................................. 461
52 -20.1002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  14  5......................QDPMAKNIQAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGE-DVVEKEMYTFEDRN----GDSLTLRPEGTAGCVRAGIEH-GLLYNQEQRLWYIGPMFRHERPQKG--RYRQFHQLGCEVFGLQGPDIDAELIMLTARWWRISEHVTLELNSIGSLEARANYRDAFLEQHKEKLDEDCKRRMYTNPLRLDYYNRTVFEWVTNSLGSQGTVCAGGRYDGLVEQLGRLVLLVQAVN--PEFKADPVVDIYLVASG-----ADTQSAAMALAERLRDELPGVKLMNHGGGNFKKQFARADKWGARVAVVLGESEVANGTAVVKDLRSGEQAVAQDSVAAHLRTLLG........................................................................................... 431
53 -19.8003lsq_A mol:protein length:484 Seryl-tRNA synthetase  ali model follow..  12  160TVVRTFGNTTKRAKLNHVSIMERLGMMDTSKSMAGGYVLKGGLVQLQVALVSYSLDFLVKRGYTPFYPPFFLNRDVM-GEVAQLSQFDEELYQV-----SGDGDKKYLIATSEMPIAAYHRGRWFTELKEPLKYAGMSTCFRKEADTLGIFRVHQFDKIEQFVVCSPREESWRHLEDMITTSEEFNKSLGLPYRVVNICSG-ALNNAAAKKYDLEAWFPASGA-ELVSCSNCTDYQSQSVNCRYGPNLRGTAAQNVKEY-AITRTMCCICENYQTEEGVVIPDVLRPYMIEMIRFENNAQAEGTTPDKGE....................................................................................................................................................................... 484
54 -19.4002dq0_A mol:protein length:455 Seryl-tRNA synthetase  ali model follow..  19  160...............KLHVDLLEILGGADFAKVSGSYYLLNEIVILDLALIRFALDRLIEKGFTPVIPPYMVRRFVE-EGSTSFEDFEDVIYKV-------EDEDLYLIPTAEHPLAGMHANEILDGKDLPLLYVGVSPCFRKEADTKGIFRVHQFHKVEQFVY-SRPEESWEWHEKIIRNAEELFQELEIPYRVVNICTG-DLGYVAAKKYDIEAWMPGQGK-EVVSASNCTDWQARRLNIRFRDRTDEKPRYVHTLNSATSRAIVAILENHQEEDGVRIPKVLWKY............................................................................................................................................................................................. 437
55 -19.3006blj_A mol:protein length:485 Serine-tRNA ligase  ali model follow..  15  185.................HIDIMRKLGGLATEQVGGGYFLLGDLVRMNLALQNYAIDFLAKKGYMPIYTPFFMTKEQM-KKVAQLSQFDEELYTV-----TGEGEDKYLIATSEQPIAAFHLEKRFDESELPIKYCGMSTCFRKEVDTLGIFRVHQFEKIEQFVVTSPKDNSWEMFDEMIGNSEAFYQSLGIPYRVVNIVSG-ALNNAAAKKFDLEAWFPGADEGELVSCSNCTDYQTRRLEVKYKKQGSEVEFCHMSTLTATSRTLCCIVENYQTPEGVNVPEVLQPY............................................................................................................................................................................................. 468
56 -17.9004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  12  16......LNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDT-------ELSKQIFRVDKNFCLRPMLAPNLANYLRKLDRALPD-PIKIFEIGPCYRKESDGKE--HLEEFTMLNFCQM-----GSGCTRENLESIITDFLNHLGI.............................................................................................................................................................................................................................................................................................. 186
57 -17.3005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  11  1MPALTKSQTDRLEVLLNPKDEISLNSGKPFRELKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGI-------DNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPD-PIKIFEIGPCYRKESDGKE--HLEEFTMLAFAQM-----GSGCTRENLESIITDFLNHLGI.............................................................................................................................................................................................................................................................................................. 186
58 -16.9002lw7_A mol:protein length:170 Histidine--tRNA ligase, cytoplasmic  ali model follow..  19  68.............................................................................................................................................................................................................................................................................................TETQVLVASAQKKLLEERL-----KLVSELQDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSTSREEVDVRREDLVEEIKRRTGQ.......................................................................................... 165
59 -16.9003od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  12  5........................SKPFMFEKPFGMRDTLPEWYKTKKNICDQMTEEINLWGYDMIETPTLEYYETVGVVSAILD---QQLFKLLDQQG----NTLVLRPDMTAPIARLVASSLKD-RAYPLRLAYQSNVYRAQQNEGG--KPAEFEQLGVELIGDGTASADGEVIALMSRLMNLLSLRGGRAAIEEARGLIQTEKGKTALAEMTKLYEVLESYGASEYVKFDLTLVLHMSY-YTG-SGGRYDELLSKFHRPAQATGFGVRIDLLVEALNGEIISNGHEQTCILFSNERRFEAI-----ELARKKRANGEAVVLQ--LAGVTDVDAMSSNYQDVIYCIGTAGRGGEDA....................................................................................................................... 400
60 -16.6004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  12  26TDRLEVLLNPKDEISLNSGKPFREESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGI-------DNDTELSKQIFRVDKNFCLRPMLAPNLGNYLRKLDRALPD-PIKIFEIGPCYRKESDGKE--HLEEFTMLNFCQM-----GSGCTRENLESIITDFLNHLGI.............................................................................................................................................................................................................................................................................................. 203
61 -16.6003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  12  30......LNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGI-------DNDTELSKQIFRVDKNFCLRPMLTPNLYNYLRKLDRALPD-PIKIFEIGPCYRKESDGKE--HLEEFTMLVFWQM-----GSGCTRENLESIITDFLNHLGI.............................................................................................................................................................................................................................................................................................. 200
62 -16.5002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  17  58.RAFQGIEHQLMSQGKRHLEQLRTVKHRP----------------ALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEDH--------LFSQVFWLDGKKCLRPMLAPNLYTLWRELERLW-DKPIRIFEIGTCYRKESQGAQ--HLNEFTMLNLTELGTPLEERHQRLEDMARWVLE..................................................................................................................................................................................................................................................................................................... 214
63 -16.0004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  13  19..........DEISLNSGKPFRELESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDT-------ELSKQIFRVDKNFCLRPMVAPNIFNYARKLDRALPD-PIKIFEIGPCYRKESDGKE--HLEEFTMLNFFQMGSTRENLESIITDFLNHL....................................................................................................................................................................................................................................................................................................... 183
64 -14.6002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  13  40..........SLNSGKPFRELESELLSRRKKDLQ---IYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGI-------DNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPD-PIKIFEIGPCYRKESDGKE--HLEEFTMLNFCQM-----GSGCTRENLESIITDFLNHLGIDFKIVGDSC..................................................................................................................................................................................................................................................................................... 212
65 -13.7004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  11  33LNPKDEISLNSGKPFRELESELLSRRKKDLQQ-----IYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDT--------LSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPD-PIKIFEIGPCYRKESDGKE--HLEEFTMLSFIQM-----GSGCTRENLESIITDFLNHLGIDFKIVGDS----------CMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKP----------WIGAGFGLERLLKVKHDFKN.......................................................................................................................................................................................................... 267
66 -11.9006FTT Entity 1(prereleased)  ali follow..  5.................................DGVADVLFEDAHKQEVLRHQLTQQLITHGYQLVSPPMIEFTESLLSGAS--EDLKRQTFKIIDQLT---GRLMGIRA---DITPQILRIDAHHGGDGIARYCYAGDVIHTLPSGLF--GSRTPLQLGAEIFGCESIAADIE---LIDVLFSMINSLDMS-----AVLHVDLGHVTIFKRLAELAALSASDTEQLMQLYANKNLPELKQVCQVLPMGSDFYTLARFGHDIANLLGRLSEN----------------------AQQDTKIVTAIDELQRLKAHLQVQWCAVSIDVTELSGYHY-VFNGYINSETQPLVRGGR-------MKSNQLATNQPRQATGFSMDVSRLLAHTQLDAPFIVLIDYDDSAQRQLLLQQVASLRQQGYRVTMPLTAEDMPVGLTHRLSLA.................................. 379
67 -11.9005m8h_A mol:protein length:388 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  5.................................DGVADVLFEDAHKQEVLRHQLTQQLITHGYQLVSPPMIEFTESLLSGAS--EDLKRQTFKIIDQLT---GRLMGIRA---DITPQILRIDAHHGGDGIARYCYAGDVIHTLPSGLF--GSRTPLQLGAEIFGCESIAADIE---LIDVLFSMINSLDMS-----AVLHVDLGHVTIFKRLAELAALSASDTEQLMQLYANKNLPELKQVCQVLPMGSDFYTLARFGHDIANLLGRLSEN----------------------AQQDTKIVTAIDELQRLKAHLQVQWCAVSIDVTELSGYHY-VFNGYINSETQPLVRGGR-------MKSNQLATNQPRQATGFSMDVSRLLAHTQLDAPFIVLIDYDDSAQRQLLLQQVASLRQQGYRVTMPLTAEDMPVGLTHRLSLA.................................. 379
68 -11.8003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  11  1.......SNAMNGTRSAWGARAWEAVRGFADRPPGMQDGYPDFAKRRRAVETRLLSFVEDAGYEPVTSGLFEYVDTLLRARS--PESSRDWIRLFDGGG----DAVALRPEMTPSIARMAAPRVAA-GRTPIRWCYCERVYRRTDDPASL-KAAESTQVGIERIGEEASVDVDM--DVLRLLHEASAAAGV.............................................................................................................................................................................................................................................................................................. 179
69 -11.8001z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  10  1..............MRGSGSIEGRMEKINYLLPEESAEMTLNQVKSLRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGKTFQEKMFQFIKHEG----QSITLRY---DFTLPLVRLYSQIKDSTSARYSYFGKIFRKEKRHKG--RSTENYQIGIELFGESADKSELE---ILSLALQVIEQLGLN----------------------KTVFEIGSAKFFQRLCQLADGSTELLTELLLKKDLSGLNAFIEKNNFSKELRGLLKEIFITNE------------SRLENLVTNTKDDVLISSFDQLKEFSEKLSMIKPIIIDLGMVPKMDYYKAYSSAANQPILSGGR------------SNFQEEAFAIGFCCHMDTILKALERQELEEDND............................................................................... 338
70 -10.2003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  13  1....MGSSSSGLVPRGSHMSETASWQPSASIPN----------LLKRAAIMAEIRRFFADRGVLEVETPCMSQATV---TDIHLVPFETRFV----GPGHSQGMNLWLMTSPEYHMKRLLVAGCG-------PVFQLCRSFRNE---MGRYHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPLSADKTQLREVAAKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGKEKPTFVYHFPAS---QASLAQISTED-----HRVAERFEVYYKGIELANGFHELTDAREQ-QQRFEQDNRKRAARGLPQHPIDQNLIEALKVGMPVMLALGAETLAE........................................................................................................................ 330
71 -9.4303g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  13  17...........................................LLKRAAIMAEIRRFFADRGVLEVETPCMSQATV---TDIHLFPFETRFV----GPGHSQGINLYLMTSPEYHMKRLLAAGCG-------PVFQLCRSFRNE---MGRHHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCQPAESLSYQQAFQRHLEIDPLSADKTQLREAAAKLDLSNIADTEEDRDTLLQLLFTMGVEPHIGKEKPTFIYHFPAS---QASLAQISTED-----HRVAERFEVYYKGIELANGFHELTDAREQ-QQRFEQDNRKRAARGLPQQPIDQNLLDALAAGLPVMLALGAESLAD........................................................................................................................ 317
72 -9.2505hgq_A mol:protein length:524 Lysine--tRNA ligase  ali model follow..  14  149.HTHFGLKNQETRYRMRYLDLIMNPDVKN--------------FVTRSRMISFLRRYLDNLGFLEVETPMMNLIA------------GGATAKPFITHHNDLDMDLYLRVAPELYLKMLVVGGID-------RVYEIGRVFRNE----DQTHNPEFTSCEFYMAYADYEDLMKITEDMLARMVYYMHGTYKIQYHPNGIVENPVYEVDFTPPFRKVNIYDGLQEKLGIQFPPADTLDTDEANKFFDKLAVENNVECPAPRTTARLLDKLIGEFLEPT-FISPTFLTGHPQIMSPLAKWHRSIPGLTERFELRLRFDEQAKQKQAGDDEAQNIDENYCTALEYGLPAMILTDSNNIKEVLFFPAMRPDEKGTNVLDE..................................................................................................... 520
73 -9.1803bju_A mol:protein length:521 Lysyl-tRNA synthetase  ali model follow..  13  147.HLHFGLKDKETRYRQRYLDLILNDFVRQ--------------FIIRSKIITYIRSFLDELGFLEIETPMMNIIP------------GGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGID-------RVYEIGRQFRNE----DLTHNPEFTTCEFYMAYADYHDLMEITEKMVSMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVLEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVT-----CINPTFICDHPQIMSPLAKWHRSKEGLTERFELRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPAMFLTDSNNIKEVLLFPAMKPEDKKE.......................................................................................................... 512
74 -9.1004ycv_A mol:protein length:516 Lysine--tRNA ligase  ali model follow..  11  146LPMKYGLKDTEIRYRQRYLDLLINESSRH--------------FVTRTKIINFLRNFLNERGFFEVETPMMNLIA------------GGANARPFITHHNDLDLDLYLRIATELPLKMLIVGGID-------KVYEIGKVFRNE----DNTHNPEFTSCEFYWAYADYNDLIKWSEDFFSLVYHLFGTYKISYNKDGPENQPIEIDFTPPYPKVSIV----EEIEKVTNTILEQPFDSNETIEKMINIIKEHKIELPNPPTAAKLLDQLASHFIENKYNDKPFFIVEHPQIMSPLAKYHRTKPGLTERLEMKECFKLQQKDREKGDTEAAQLDSAFCTSLEYGLPTMFLTNKNSIKDVILFPTMRPANGG........................................................................................................... 510

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 4 5 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.