current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 1nj1_A mol:protein length:501 Proline-tRNA Synthetase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .
# Score Template Links and tools%idFirst MGSSSSGLVPRGSHMQKPIKKDPNRYHGEKMTEFSEWFHNILEEAEIIDQRYPVKGMHVWMPHGFMIRKNTLKILRRILDRDHEEVLFPLLVPEDELAKEAIHVKGFEDEVYWVTHGGLSKLQRKLALRPTSETVMYPMFALWVRSHTDLPMRFYQVVNTFRYETKHTRPLIRVREITTFKEAHTIHATASEAEEQVERAVEIYKEFFNSLGIPYLITRRPPWDKFPGSEYTVAFDTLMPDGKTLQIGTVHNLGQTFARTFEIKFETPEGDHEYVHQTCYGLSDRVIASVIAIHGDESGLCLPPDVAAHQVVIVPIIFKKAAEEVMEACRELRSRLEAAGFRVHLDDRDIRAGRKYYEWEMRGVPLRVEIGPRDLEKGAAVISRRDTGEKVTADLQGIEETLRELMKDILENLRTRAWERMESEIREAETLEEASRIVDEKRGIISFMWCGEEECGMDVEEKVRVDILGIQEEGSGTCINCGREAPYRAYLARTYLast
1 -159.0001nj1_A mol:protein length:501 Proline-tRNA Synthetase  ali model  100  1MGSSSSGLVPRGSHMQKPIKKDPNRYHGEKMTEFSEWFHNILEEAEIIDQRYPVKGMHVWMPHGFMIRKNTLKILRRILDRDHEEVLFPLLVPEDELAKEAIHVKGFEDEVYWVTHGGLSKLQRKLALRPTSETVMYPMFALWVRSHTDLPMRFYQVVNTFRYETKHTRPLIRVREITTFKEAHTIHATASEAEEQVERAVEIYKEFFNSLGIPYLITRRPPWDKFPGSEYTVAFDTLMPDGKTLQIGTVHNLGQTFARTFEIKFETPEGDHEYVHQTCYGLSDRVIASVIAIHGDESGLCLPPDVAAHQVVIVPIIFKKAAEEVMEACRELRSRLEAAGFRVHLDDRDIRAGRKYYEWEMRGVPLRVEIGPRDLEKGAAVISRRDTGEKVTADLQGIEETLRELMKDILENLRTRAWERMESEIREAETLEEASRIVDEKRGIISFMWCGEEECGMDVEEKVRVDILGIQEEGSGTCINCGREAPYRAYLARTY 495
2 -130.0003ial_A mol:protein length:518 Prolyl-tRNA synthetase  ali model follow..  34  2.................AMGGDVTFSLTKTRDTFADWFDAIMDAAELVDRRYPVKGCVVFRPYGFFMENAIMRLCEEEYAKGISQILFPTVIPESFLKKESDHIKGFEAECFWVEKGGLQPLEERLALRPTSETAIYSMFSKWVRSYKDLPLKIHQTCTIFRHETKNTKP-LIRVREIHWNEAHCCHATAEDAVSQLSDYWKVIDTIFSDELFKGQKLRRVCWDRFPGADYSEVSDVVMPCGRVLQTAGIHNLGQRFSSTFDILYANKANESVHPYLTCAGISTRVLACALSIHGDSGGLVLPPLIAPIHVVIIPIGCGKKNQQVLGKVNEIADTLSKLGLRVSIDDDSKSMGDKLYYYELKGVPLRIEVGQRDLANGQCIVVPRDVGKDQVIPITEVMKVSSDELDAYKARLKEKAFAFHNSMVTNCKSFDEIVACIENKGGLARFPFYTTEADGEVWDKACSAEIRGHNPDENEVCALSGKPAVCYMYCAKSY 512
3 -130.0004ncx_A mol:protein length:506 Proline--tRNA ligase  ali model follow..  29  1.................MASNILGITS-KKIENFSDWYTQVIVKSELIEYYD-ISGCYILRPAAYYIWECVQAFFNKEIKKNVENSYFPLFVTKNKLEKEKNHIEGFSPEVAWVTKYGDSNLPEEIAIRPTSETIMYSVFPKWIRSYRDLPLKLNQWNTVVRWEFKQPTPFI-RTREFLWQEGHTAHKNEEEAVKLVFDILDLYRRWYEEYLAPIIKGIKSEGEKFGGANFTSTAEAISENGRAIQAATSHYLGTNFAKMFKIEFEDENEVKQYVHQTSWGCTTRSIGIMIMTHGDDKGLVLPPNVSKYKVVIVPIFYKTDENAIHSYCKDIEKILKNAQINCVYDDRSYSPGYKFNHWELRGIPIRIEVGPKDLQNNSCVIVRRDNNEKCNVKKESVLLETQQMLVDIHKNLFLKAKKKLDDSIVQVTSFSEVMNALNKKK-MVLAPWCEDIATEEEIKKETAMKPLCIPLDQPMKCFWSGKPAKRWCLFGRSY 500
4 -129.0005f9y_A mol:protein length:511 Aminoacyl-tRNA synthetase  ali model follow..  33  2..............ASKENESLLGITA-DKITSFADWYSQVIVKSEMIEYYD-ISGCYILRPWSYFIWETIQSVFDQKIKQDVQNAYFPIFVTQKKLETEKDHVEGFSPEVAWVTKSGKSDLAEPIAIRPTSETIMYPYFAKWIRSHRDLPLKINQWTSIVRWEFKHPTP-FIRTREFLWQEGHTAHSTRKEALEMVDIILNEYASIYEDLATPVVKGTKSENEKFPGGDITKSIEGFIEIGRAVQAATSHLLGQNFSKMFGVEFEDEKGNKEYAHQTSWGLTTRAIGVMIMTHGDNKGLVLPPKVAPVQVIIIPIIFKVITEEQKKICNEVECILKKAGVRVKIDDRNYTPGWKYNHWEVKGVCLRFEVGPRDIEKRSVRVVVRDNMEKMDIPISELESKIPKLLEEFQNRLLFKAKQRQNESIIRVDTFDKVMDTLNQKK-MVIAPWCEDVSCEEEIKKETAMKSLCIPNDQITKCFFCDKLAKKFTLFGRSY 505
5 -129.0005xif_A mol:protein length:500 Prolyl-tRNA synthetase (ProRS)  ali model follow..  35  3........................MVTAKKDENFSEWYTQAIVRSEMIE-YYDISGCYIMRPWAFHIWEKVQRFFDDEIKKGVENSYFPMFVSRHKLEKEKDHVEGFSPEVAWVTHYGDSPLPEKIAIRPTSETIMYPAYAKWIRSHRDLPLKLNQWCSVVRWEFKQPTPFL-RTREFLWQEGHTAHATEEEAWELVLDILELYRRWYEECLAPVIKGEKSEGEKFAGGKKTTTVEAFIENGRGIQAATSHLLGTNFAKMFEIEFEDEEGHKRLVHQTSWGCTTRSLGVMIMTHGDDKGLVIPPRVASVQVVIIPILKDENTGEILGKCRELKTMLEKADIRVRIDDRNYTPGWKYNHWEVKGVPLRLELGPKDLAKGTARVVRRDTGEAYQISWADLAPKLLELMEGIQRSLFEKAKARLHEGIEKISTFDEVMPALNRKH-LVLAPWCEDPESEEQIKKETAMKTLCIPFDQPTKCFYTGKPAKRWTLWGRSY 500
6 -128.0004hvc_A mol:protein length:519 Bifunctional glutamate/proline--tRNA ligase  ali model follow..  33  3..........SGEGQGPKKQTRLGLEA-KKEENLADWYSQVITKSEMIEY-HDISGCYILRPWAYAIWEAIKDFFDAEIKKGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFL-RTREFLWQEGHSAFATMEEAAEEVLQILDLYAQVYEELLAPVVKGRKTEKEKFAGGDYTTTIEAFIASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFANSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNAKEALIAKCNDYRRRLLSVNIRVRADLRNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILEDIQVTLFTRASEDLKTHMVVANTMEDFQKILDSGK-IVQIPFCGEIDCEDWIKKTTGAKSLCIPFKPLAKCVCGKNPAKYYTLFGRSY 513
7 -127.0001nj8_A mol:protein length:459 Proline-tRNA Synthetase  ali model follow..  58  1...........................GSHMLEFSEWYSDILEKAEIYDVRYPIKGCGVYLPYGFKIRRYTFEIIRNLLDEGHDEALFPMLIPEDLLAKEAEHIKGFEDEVYWVTHGGKTQLDVKLALRPTSETPIYYMMKLWVKVHTDLPIKIYQIVNTFRYETKHTRPLIRLREIMTFKEAHTAHSTKEEAENQVKEAISIYKKFFDTLGIPYLISKRPEWDKFPGAEYTMAFDTIFPDGRTMQIATVHNLGQNFSKTFEIIFETPTGDKDYAYQTCYGISDRVIASIIAIHGDEKGLILPPIVAPIQVVIVPLIFKGKEDIVMEKAKEIYEKL-KGKFRVHIDDRDIRPGRKFNDWEIKGVPLRIEVGPKDIENKKITLFRRDTMEKFQVDETQLMEVVEKTLNNIMENIKNRAWEKFENFITILEDIDEIKNILSEKRGVILVPFKEEIYNEELEEK-VEATILGETEYKGNKYIAIA----------KTY 459
8 -127.0005xip_A mol:protein length:498 Prolyl-tRNA synthetase, putative  ali model follow..  34  4........................GVTAKKSTNFADWYTQVIVRGELVEY-YDISGCYIIRPWAYRIWEAVQKFFDDGIKRGVENCYFPMFVSQAKLEKEKDHVEGFKPEVAWVTHYGDSELPEKVAIRPTSETIMYPAYAKWIRSHRDLPLKLNQWNNVVRWEFKQPTPFL-RTREFLWQEGHTAHATEEEAYTLVLEILELYRQWYEDYLAPVIKGEKSENEKFAGGKKTTTIEGIIPDGRGIQAATSHLLGQNFSRMFSIEFEDEKGAKQLVHQTSWGCTTRSLGVMIMTHGDDKGLVLPPRVVAVQAVIIPIIKETGGMEIVAKCRELERLLNAAGVRVKVDDRNYTPGWKFNDWELKGVPLRLEIGPRDVESCQTRVVRRDTSEARNVPWAEAASTIPAMLETMQKDLFNKAKAKFEASIEQITTFDEVMPALNRRH-VVLAPWCEDPETETQIKRETAMKPLCIPFDQPTRCFFTGRPAKRWCLFGRSY 498
9 -127.0004k86_A mol:protein length:535 Proline--tRNA ligase  ali model follow..  31  8LVPRGSHMASGAGEGQGPKKQTRLGLEAKKEENLADWYSQVITKSEMIEY-HDISGCYILRPWAYAIWEAIKDFFDAEIKKGVENCYFPMFVSQS-ALEKEKTHVADFAPEVWVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFL-RTREFLWQEGHSAFATMEEAAEEVLQILDLYAQVYEELLAPVVKGRKTEKEKFAGGDYTTTIEAFIASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNAKEALIAKCNDYRRRLLSVNIRVRADLRNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILEDIQVTLFTRASEDLKTHMVVANTMEDFQKILDSGK-IVQIPFCGEIDCEDWIKKTTGAKSLCIPFKPLAKCVCGKNPAKYYTLFGRSY 529
10 -125.0001h4q_A mol:protein length:477 PROLYL-TRNA SYNTHETASE  ali model follow..  38  1..................MAKEKGLTP--QSQDFSEWYLEVIQKAELADYG-PVRGTIVVRPYGYAIWENIQQVLDRMFKEGHQNAYFPLFIPMSFLRKEAEHVEGFSPELAVVTHAGGEELEEPLAVRPTSETVIGYMWSKWIRSWRDLPQLLNQWGNVVRWEMRTR--PFLRTSEFLWQEGHTAHATREEAEEEVRRMLSIYARLAREYAAPVIEGLKTEKEKFAGAVYTTTIEALMKDGKALQAGTSHYLGENFARAFDIKFQDRDLQVKYVHTTSWGLSWRFIGAIIMTHGDDRGLVLPPRLAPIQVVIVPIYKDESRERVLEAAQGLRQALLAQGLRVHLDDRQHTPGYKFHEWELKGVPFRVELGPKDLEGGQAVLASRLGGKE-TLPLAALPEALPGKLDAFHEELYRRALAFREDHTRKVDTYEAFKEAVQ--EGFALAFHCGDKACERLIQEETTATTRCVPFEAEGFCVRCGRPSAKRVVFAKAY 477
11 -119.0005xil_A mol:protein length:512 Putative prolyl-tRNA synthetase  ali model follow..  32  7...........................AKREENFSAWYIDVITKAEMIE-YYDVSGCYIIRPWAYYVWKCVQRFLGGKIEKGVEDCYFPMFVSRSCLEREKDHIEGFAPEVAWVTRAGDTELEQPVAVRPTSETVMYPYYAKWIRSHRDLPVRLNMWNNVIRWEFSHPTP-FIRTREFLWQEGHCAWAKAEECAKEVLEILECYASVYEQLLAPVVRGRKTEKEKFAGGDYTTTVETFIAVGRGCQGATSHNLGQNFGKMFDIRFQDPENNEQTLIPNSWGLSTRVIGVMIMVHGDNRGMVMPPRVASTQVIIIPVGITKDTQELLASCWRLESELCEGGVRARCDLRDNSPGWRFNHWEVKGVPLRVELGPRELAERSLAVAVRHSGARHSVAWDAQTPAAAALLEDVHAQMYARAKETMETHRVRVTEWTEFVPTLNRKC-LILAPWCGAMECENQVKKDSGAKTLCIPFEQPEICKGCTKPATTWVLFGRSY 512
12 -84.4002i4l_A mol:protein length:458 Proline-tRNA ligase  ali model follow..  24  1MGSSSSGLVPRGSHM--RLSRFFLPILKENPKEAEIVSHRLMLRAGML--RQEAAGIYAWLPLGHRVLKKIEQIVREEQNRGAIELLMPTLQLAD-LWRESGRYDAYGPEMLRIA----DRHKRELLYGPTNEEMITEIFRAYIKSYKSLPLNLYHIQWKFRDEQRPRFG-VMRGREFLMKDAYSFDVDEAGARKSYNKMFVAYLRTFARMGLKAIPMRAETGPIGGDLSHEFIVEANRLNTRGIEVGQIFYFGTKYSDSMKANVTGPDGTDAPIHGGSYGVVSRLLGAIIEACHDDNGIIWPEAVAPFRVTILNL--KQGDAATDAACDQLYRELSAKGVDVLYDDTDQRAGAKFATADLIGIPWQIHVGPRGLAEGKVELKRRSDGARENLALADVVARLT............................................................................................ 452
13 -84.0002j3l_A mol:protein length:572 PROLYL-TRNA SYNTHETASE  ali model follow..  21  2.................KQSKMLIPTLREVPNDAEVLSHQILLRAGYI--RQVAAGIYSYLPLANRVLEKLKTIMREEFEKDAVEMLMPALLPAE-LWKESGRYETYGPNLYRLK----DRNDRDYILGPTHEETFTELIRDEINSYKRLPLNLYQIQTKYRDEKRSRSGLL-RGREFIMKDGYSFHADEASLDQSYRDYEKAYSRIFERCGLEFRAIIGDGGAMGGKDSKEFMAISVLAFTKGIEIGHIFKLGTRYSDAMGATVLDENGREKSVIMGCYGIVSRLLSAIVEQNADERGINWPTGIAPFDLHVVQM--NVKDEYQTKLSQEVEAMMTEAGYEVLVDDRNERAGVKFADADLIGCPIRITVGKKAVD-GVVEVKIKRTGEMLEVRKEELESTLSILMNTTSEV................................................................................... 571
14 -72.2004p3n_A mol:protein length:415 Threonine--tRNA ligase, cytoplasmic  ali model follow..  16  2...............................GSSSSGDHRKIGRQELYFFHELSPGSCFFLPKGAYIYNALIEFIRSEYKRGFQEVVTPNIF-NSRLWMTSGHWQHYSENMFSF-----EVEKELFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGALTGLTRVRRFQQDDAH-IFCAMEQIEDEIKGCLDFLRTVYSVFGFSFKLNLSTRPEKFLGDIEVWDDIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVSHDGDDKKVHRAILGSVERMIAILT----ENYGGKWPFWLSPRQVMVVPV-----GPTCDEYAQKVRQQFHDAKFMADIDDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERTISETIERLQQLKEFRSKQAEEE............................................................................... 408
15 -72.1005ucm_A mol:protein length:579 Proline--tRNA ligase  ali model follow..  22  4.................RTSQYLLSTLKETPADAVVISHQLLLRAGMI--RRLASGLYTWLPMGLRVLRKVETIVREEMNAGALEVLMPAVQPAE-LWQESGRWEQYGPELLRLK----DRHEREFCVGPTHEEVITDLARNELNSYKQLPINFYQIQTKFRDEIRPRFG-LMRGREFIMKDAYSFHLSQDSLQQTYDGMYQAYSKIFSRLGLDFRPVQADNGSNVVEGDPSPDGKGTLVIKRGIEVGHIFQLGTKYSEAMKLSVLSEQGKPVNLIMGCYGIVSRVVAAAIEQNHDERGILWPSALAPFQIALVPL--KYETESVKQATDKLYAELTAAGFEVLLDDRDKSPGVKFADMELIGIPHRIVISDRGLSEGVLEYKGRRDSESQNLPIGELMSFITEKLSR....................................................................................... 573
16 -70.0004hwt_A mol:protein length:413 Threonine--tRNA ligase, cytoplasmic  ali model follow..  16  2...................................ARDHRKIGRQELYFFHELSPGSCFFLPKGAYIYNALIEFIRSEYKRGFQEVVTPNIF-NSRLWMTSGHWQHYSENMFSF-----EVEKELFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGALTGLTRVRRFQQDDAH-IFCAMEQIEDEIKGCLDFLRTVYSVFGFSFKLNLSTRPEKFLGDIEVWDDIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVSHDGDDKKVHRAILGSVERMIAILT----ENYGGKWPFWLSPRQVMVVPV-----GPTCDEYAQKVRQQFHDAKFMADIDDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERTISETIERLQQLKEFRSKQAEEEFLE............................................................................ 407
17 -67.9001nyq_A mol:protein length:645 threonyl-tRNA synthetase 1  ali model follow..  18  197.LLSTAGAYWRGDSNNKMLQRIYGTAFFDKKEERKERDHRKIGKLELFTNQLVGAGLPLWLPNGATIRREIERYIVDKESMGYDHVYTPVLA-NVDLYKTSGHWDHYQEDMFPPM---QLDETESMVLRPMNCPHHMMIYANKPHSYRELPIRIAELGTMHRYEASGAVSGLQRVRGMTLNDSH-IFVRPDQIKEEFKRVVNMIIDVYKDFGFEDYSFRLSYRDPEDKEKYFDDDDQVKTAMGKEETLSTAQLDFLLPERFDLTYIGQDGEHHRPVVIHVSTMERFVAFLT----EETKGAFPTWLAPKQVQIIPV----NVDLHYDYARQLQDELKSQGVRVSIDDRNEKMGYKIREAQMQKIPYQIVVGDKEVENNQVNVRQYGSQDQETVEKDEFIWNLVDEIRLKKHR................................................................................... 645
18 -66.3003ugq_A mol:protein length:460 Threonyl-tRNA synthetase, mitochondrial  ali model follow..  16  2...........GSSSSGLVPRGSHMASATKNSATPATMTSMVSQQDLFMTDPLSPGSMFFLPNGAKIFNKLIEFMKLQQKFGFNEVVTPLIY-KKTLWEKSGHWENYADDMFKVET--TDEEKEEYGLKPMNCPGHCLIFGKKDRSYNELPLRFSDFSPLHRNEASGALSGLTRLRKFHQDDGH-IFCTPSQVKSEIFNSLKLIDIVYNKIFPFVKGGSSTRPDHFIGDLKVWNDIMVTDHLRKTHQVATIQLDFQLPERFDLKFKDQDNSYKRPIMIHFGSIERFMALLI----DSNEGRWPFWLNPYQAVIIPVNTKNVQRNELEADDMEPVPLNDWHFNVDLDIRNEPVGYRIKSAILKNYSYLIIVGDEEVQLQKYNIRERDNRKSEKLTMSQIWEKFIELEKNYK..................................................................................... 454
19 -66.2004hwo_A mol:protein length:411 Threonine--tRNA ligase  ali model follow..  17  2...................................ARDHRKIGKLDLYHMQEEAPGMVFWHNDGWTIFRELEVFVRSKLEYQYQEVKGPFMM-DRVLWEKTGHWDNYKDAMFTT-----SSENREYCIKPMNCPGHVQIFNQGLKSYRDLPLRMAEFGSCHRNEPSGSLHGLMRVRGFTQDDAH-IFCTEEQIRDEVNGCIRLVYDMYSTFGFEKIVVKLSTRPEKRIGSDEMWDRALYDCLDRAWQCGTVQLDFSLPSRLSASYVGEDNERKVPVMIHLGSMERFIGILT----EEFAGFFPTWLAPVQVVIMNI-----TDSQSEYVNELTQKLSNAGIRVKADLRNEKIGFKIREHTLRRVPYMLVCGDKEVESGKVAVRTRRGKDLGSMDVNEVIEKLQQEIRSRSLKQLEE............................................................................... 403
20 -65.6003a31_A mol:protein length:471 Probable threonyl-tRNA synthetase 1  ali model follow..  13  5...................QDKTHIDYAYELDITVKPDSRVPVF-NREFATFTGAGVPLFSLGGGPIRYALAEVLAKFHRRGYYVVETPIIA-STELFKVSGHIEFYRNNMYLF-----DIEGHEFAVKPMNCPYHILLFLNEVASKLPLPFKVFEFGRVHRYEPSGSIYGLLRVRGFTQDDAH-IIVPGGRVIDVVYDVFEEMKLVLERLFKGIDIVELEGEAAFYGPKLDFIMMVEESGVSKEWQMGTIQFDFNLPRRFRLYDVVREEFGIEIHRALLGSIERFLGVYL----EHRRGRMPFTLAPIQFAVIAVKTGGEVREIEDLASSIAKGLLDKGFRVAVKGSSKGLSSDVRHIESTAKPAVVFIGAKEVREKVLDVRVFDLESMKRRRLAIAYGDAADAVENLAAVAEELESPVRSLSGQAPRIPADFSFML......................................................... 471
21 -65.0001qf6_A mol:protein length:642 THREONYL-TRNA SYNTHETASE  ali model follow..  17  198.LMKTAGAYWRGDSNNKMLQRIYGTAWADKKEEAAKRDHRKIGKLDLYHMQEEAPGMVFWHNDGWTIFRELEVFVRSKLEYQYQEVKGPFMM-DRVLWEKTGHWDNYKDAMFTT-----SSENREYCIKPMNCPGHVQIFNQGLKSYRDLPLRMAEFGSCHRNEPSGSLHGLMRVRGFTQDDAH-IFCTEEQIRDEVNGCIRLVYDMYSTFGFEKIVVKLSTRPEKRIGSDEMWDRALYDCLDRAWQCGTVQLDFSLPSRLSASYVGEDNERKVPVMIHLGSMERFIGILT----EEFAGFFPTWLAPVQVVIMNI-----TDSQSEYVNELTQKLSNAGIRVKADLRNEKIGFKIREHTLRRVPYMLVCGDKEVESGKVAVRTRRGKDLGSMDVNEVIEKLQQEIRSRSLKQLEE............................................................................... 642
22 -49.8001b76_A mol:protein length:442 Glycine--tRNA ligase  ali model follow..  18  2...........................ASSLDELVALCKRRGFIFQSSEIYGGLQGVYDYGPLGVELKNNLKQAWWRRNRDDMEGLDASVLTHRL-VLHYSGHEATFADPMVDNAKARYGGRGLLAYLRPETAQGIFVNFKNVLDATSKLGFGIAQIGKAFRNEITPR-NFIFRVREFEQMEIE-YFVRPGEDEYWHRYWVEERLKWWQEMGLSLVPYQQPPESSAHYAKATVDILYRFPHGSLELEGIAQRTDFDLGSHTKLAYRDPETGKWYVIEPSAGVDRGVLALLAEAFEERIVLKLKPQLAPIKVAVIPLV--KNRPEITEYAKRLKARLLALGLGRVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSTVTVRDRDTMEQIRLHVDELEGFLRERLR........................................................................................ 441
23 -39.2001ati_A mol:protein length:505 GLYCYL-TRNA SYNTHETASE  ali model follow..  18  1..............................AASSLDELVALCKRRGFIFQSSEIQGVYDYGPLGVELKNNLKQAWWRRNVYERDDME--SVLTHRLVLHYSGHEATFADPMFQDLRGPRGGRGLLAYLRPETAQGIFVNFKNVLDATSRLGFGIAQIGKAFRNEITPR-NFIFRVREFEQMEIE-YFVRPGEDEYWHRYWVEERLKWWQEMGLSLVPYQQPPESSAHYAKATVDILYRFPHGSLELEGIAQRTDFDLGSHTKRDPETGKWFVPYVIEPSAGVDRGVLALLAEAFTREE-LKLKPQLAPIKVAVIPLV--KNRPEITEYAKRLKARLLALGLGRVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSTVTVRDRDTMEQIRLHVDELEGFLRERLR........................................................................................ 504
24 -36.6002pme_A mol:protein length:693 Glycyl-tRNA synthetase  ali model follow..  15  35..VDVDKAVAELKARKRVLEAKELALQPKDDIVDRAKMEDTLKRRFFYDQAFAVSGLYDFGPVGCALKNNIIQTWRQHFEEQILEIDCTMLTPEP-VLKTSGHVDKFADFMVKDVKNGEGGNMPGYLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPR-SGLIRVREFTMAEIEHFVDPSEKDHPKFQNVADLHLYLYSAYKKDAKLVMEYLAICDECYITEMEMLLNEKGEFTIETEGKTFQLTKDMINVKRFQKTLYVEEVVPNVIEPSFLGRIMYTVFEHTFHVREFSFPAVVAPFKCSVLPLS---QNQEFMPFVKELSEALTRHGVSHKVDDSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTTATLRDRDSMRQIRAEISELPSIVQDLANGNIADVEARYPLFEGQETGKKETIEELE............................................................ 687
25 -35.0002cim_A mol:protein length:522 SERYL-TRNA SYNTHETASE  ali model follow..  16  162ILTLLEEKIEAAQYGAKAEHWNLLWQREPMEHPFKEDPTQAMMKEGWLK-RGSSRGQWIHGPQSARIFRTFEKIVLEELPLGYREMIFPKLVTWEVW-MKSGHAKGVYPEIYYVCPPQTRDAEPIGGMCYAQCPPFWMYVAGETLPNEEIPVKVFDRGTSHRYESGGIHG-IERVDEFHRIEIV-WIGTKEEVLKCAEELHDRYMHIFNDILDIEWRKARVTPNTVGTTDYEACLPYRGPDGEWLEFQNVSINGDKYPKGFNVKLQSGD----ELWSGCSGVLERWAAVFLAQKGLDPA-NWP---EEFRNRVGEM................................................................................................................................................................................... 509
26 -34.9003qne_A mol:protein length:485 Seryl-tRNA synthetase, cytoplasmic  ali model follow..  13  114.....ESVVDSQDEENNELVRTWTPENYKKPEAPAKLSHHEVLLLDGYDPRIVGHRGYFLRNYGVFLNQALINYLSFLSSKGYVPLQAPVMM-NKEVMAKTAQLSQFDEELYKVI----DGEDEKYLIATSEQPISAYHAGEWFSPAEQLPVRYAGYSSCFRREAGSHAWGIFRVHAFEKIEQF-VLTEPEKSWEEFDRMIGCSEEFYQSLGLPYRVVGIVSGELNNAAAKKYDLEAWFPFQQEYELVSCSNCTDYQSRNLEIRCGIKQQNQQHCLNSTLSATERTICCILENYQKEDGLVIPEVLRKY----------PGEPEFIPYIKELPKNTTSVKKAKGKNPKNTTSVKKAKGKNGSR.................................................................................................................................... 479
27 -32.0005c51_B mol:protein length:485 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  12  33.LTERSSPKGGHVKSHAELEGNGEHPEAPGSGEGSEALLEICQRRHFLSGSKQQGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVF--LHHKPGPLLPGDSAFRLVSAETLQLVAFLENVLKTSGKLRENLLHGALEHYVNCLDLVNRLPYGLAQIGVCFHPVFDTKQNGVKSIGEKTEASL-VWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLNGDLDRGMLAYLYDSFQLTENLKLHPCLAPIKVALDVG--RGPTLELRQVCQGLFNELLENGISVYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKN.................................................................................... 484
28 -31.9002g4c_A mol:protein length:474 DNA polymerase gamma subunit 2  ali model follow..  12  15LLTERSSPKGGHVKSHAELEGNGEHPEAPGSGEGSEALLEICQRRHFLSGSKQQGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVF--LHHKPGPLLPGDSAFRLVSAETLQLVTFLENVLKTSGKLRENLLHGALEHYVNCLDLVNRLPYGLAQIGVCFHPVFDTKQNGVKSIGEKTEASL-VWFTPPRTSNQWLDFWLRHRLQWWRKFAMSFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLNGDLDRGMLAYLYDSFQLTENLKLHPCLAPIKVALDVG--RGPTLELRQVCQGLFNELLENGISVYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKN.................................................................................... 467
29 -31.0004ztu_B mol:protein length:472 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  12  8LLTERSSPKGGHVKSHAELEGNGEHPEAPGSGEGSEALLEICQRRHFLSGSKQQGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVF--LHHKPGPLLPGDSAFRLVSAETLQLVAFLENVLKTSGKLRENLLHGALEHYVNCLDLVNRLPYGLAQIGVCFHPVFDTKQNGVKSIGEKTEASL-VWFTPPRTSNQWLDFWLRHRLQWWRKFAMSFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLNGDLDRGMLAYLYDSFQLTENLKLHPCLAPIKVALDVG--RGPTLELRQVCQGLFNELLENGISVYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKN.................................................................................... 460
30 -28.9004h2w_A mol:protein length:346 Amino acid--[acyl-carrier-protein] ligase 1  ali model follow..  13  6............SGLVPRGSHMNIAVLPNSPDTAPQIADPLDHLADKLFHSMGSDGVYARTALYESIVERLAALITSHREAGTEALRFPPVMSRAQL-EKSGYLKSFPNLLGCVCGLHGTEREADLVLSPAACYPVYPIAASRGPL-PKGGLRFDVAADCFRREPS---KHLDRLQSFRMRE-YVCIGTPDDVSDFRERWMVRAQAIARDLGLTFRVDYASDP-QRDQQLKFELLIPLRSEEQPTACMSFNYHREHFGTTWGIQDANGE----PAHTGCVAFMDRLAVAMFHTHGTDLS-AWPAKVRDI.......................................................................................................................................................................................... 323
31 -28.2003mey_A mol:protein length:346 Bll0957 protein  ali model follow..  14  6............SGLVPRGSHMNIAVLPNSPDTAPQIADPLDHLADKLFHSMGSDGVYARTALYESIVERLAALITSHREAGTEALRFPPVMSRAQL-EKSGYLKSFPNLLGCVCGLHGTEREADLVLSPAACYPVYPIAASRGPL-PKGGLRFDVAADCFRREPSKH---LDRLQSFRMREY-VCIGTPDDVSDFRERWMVRAQAIARDLGLTFFFGRVGQMKAVSQKQQQLKFELLIPEEQPTACMSFNYHREHFGTTWGIQDANGE----PAHTGCVAFMDRLAVAMFHTHGTDLS-AWPAKVRDI.......................................................................................................................................................................................... 323
32 -28.1001g5h_A mol:protein length:454 MITOCHONDRIAL DNA POLYMERASE ACCESSORY SUBUNIT  ali model follow..  12  1.........WLSGYAGPADGTQQPDAPEHAVADLCRRRHFLSGTPQQLSTAALLSGCHAFGPLGVELRKNLASQWWSSMVVFREQVF-SLHQEPGSSQPRDSAFRLVSPESEQLVAFLENLLKTSGKLRATLLHGALEHYVNCLDLVNKLPFGLAQIGVCFHPVSNSNQTSVTRVGEKTEASL-VWFTPTRTSSQWLDFWLRHRLLWWRKFAMSPSNFSSADCQDELGRKGSKLYYSF-EPIETLWNLGDQELLHTYPGNVSTIQGRDGRKNVVPCVLSGDVDLGTLAYLYDSFQLAENLKLHPCLAPIKVALDVG--KGPTVELRQVCQGLLNELLENGISVYSETVHSSLEQLHSKYDEMSVLFSVLVTETTLENGLIQLRSRDTTMKEMMHISKLRDFLVKYLASASN.................................................................................... 442
33 -26.8003ikl_A mol:protein length:459 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  11  32LLTERSSPKGGHVKSHAELEGNGEHPEAPGSGEGSEALLEICQRRHFLSDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPV------------------DALHHKPGPLLPGDSAFRGGLRENLLHGALEHYVNCLDLVNRLPYGLAQIGVCFHPVFDTKQNGVKSIGEKTEASL-VWFTPPRTSNQWLDFWLRHRLQWWRKFAMSFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLNGDLDRGMLAYLYDSFQLTENLKLHPCLAPIKVALDVG--RGPTLELRQVCQGLFNELLENGISVYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKN.................................................................................... 452
34 -23.6005c53_B mol:protein length:903 Pol gamma B  ali model follow..  11  367............QGLFNELLENGISVWPGYLETMQSSLEQLYSKYDLVTETTLENGLIHLRSRDTTMKEMLKDFLIKYISSAKNVMRSRVAVCRCLLSGFGGRVDAGQPELLHHKPGPLLPGDSAFRLRENLLHGALEHYVNCLDLVNRLPYGLAQIGVCFHPVFDTKQNGVKSIGEKTEASL-VWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNF-ELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLNGDLDRGMLAYLYDSFQLTENLKLHPCLAPIKVALDVG--RGPTLELRQVCQGLFNELLENGISVYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKN.................................................................................... 902
35 -23.2001qe0_A mol:protein length:420 Histidine--tRNA ligase  ali model follow..  15  3...................................................KIPRGTQDILPEDSKKWRYIENQLDELMTFNYKEIRTPIFESTDLFARGVGD-DVVQKEMYTFK----DKGDRSITLRPEGTAAVVRSYEHKMQGNPNQPIKLYYNGPMFRYERKQK-----RYRQFNQFGVEAIGAENPSVDAE---VLAMVMHIYQSFGLKEAIKTAPRITDFLNEESKAYYEQVKAYLDDLGIPYTEDLDYYTHTAFELMMDNPNYDGAITTLCGGGRYNGLLELLDGPSETGIGFALLDIEENLDLFIVTM-----GDQADRYAVKLLNHLRHNGIKADKDYLQRKIKGQMKQADRLGAKFTIVIGDQELENNKIDVKNMTTGESETIELDALVEYFKK........................................................................................... 420
36 -23.1001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  15  7...................................................EKIRGFRDFYPEDMDVEKFIFKTAEEAAEAGFRRIDFPSLEYLDLYRIKSG--EELLQQTYSFV----DKGGREVTLIPEATPSTVRMVTS--RKDLQRPLRWYSFPKVWRYEEPQA-----RYREHYQFNADIFGSDSPEADAE---VIALASSILDRLGLQDIYEIREMARITGKSSEEIARMAAVEDLLASYGVKNVRYDFSIVRGLSIVFEAYDRSGQFRAILGGGRYDNLASLMSGESVPAVGFGM-IPREKKSVYICRV-----GKINSSIMNEYSRKLRERGMNVTVEIMERGLSAQLKYASAIGADFAVIFGERDLERGVVTIRNMYTGSQENVGLDSVVEHLISQATL....................................................................................... 427
37 -22.6003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  15  24...................................................EPVQGCRDFPPEAMRCRRHLFDVFHATAKTGFEEYDAPVLESEELYIRKAG--EEITEQMFNFI----TKGGHRVALRPEMTPSLARLLLGKGRSLL-LPAKWYSIPQCWRYEAITR-----RRREHYQWNMDIVGVKSVSAEVE---LVCAACWAMRSLGLSSKDVGIKVNSR-EEHEAVKELRQFFEQVEAYGYGDWVLFDASVVRGLAIVFEGFDREGKFRALCGGGRYDNLLTTYIVELLQEKRLL-PDIPHVVDDVVIPF-----DESMRPHALAVLRRLRDAGRSADIILDKKKVVQAFNYADRVGAVRAVLVAPEEWERGEVQVKMLREGTGKEEGGAERGFAVPL........................................................................................... 446
38 -22.3003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  16  24...................................................EPVQGCRDFPPETMRLRKYLFDVFHSTARKGFEEYDSPVLESEELYIRKAG--EEITEQMFNFI----TKGGHRVALRPEMTPSLARQLLAKGRSLL-LPAKWYSIPQCWRYEAITR-----RRREHYQWNMDIIGVKSVSSEVE---LVCAACTAMQSLGLSSKDVGVKINSRKEEHEAVRELRDFITQIEAYGFGDWVIFDASVVRGLAIVFEGFDRDGNFRALCGGGRYDNLLTTYIVELLNEKK-LLPELHHVVDDLVIPF-----DETMRPHALSILRRLRDAGRSADIVFDKKKVVQAFNYADRIGALRAVLVAPDEWARGEVRVKMLREGAGREEGANERGIVLPV........................................................................................... 446
39 -22.2001v95_A mol:protein length:130 Nuclear receptor coactivator 5  ali model follow..  7..................................................................................................................................................................................................................................................................................................................GPVDCSVIVV-----NKQTKDYAESVGRKVRDLGMVVDLINTEVSLSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTEHRNMPQADAMVLVARNYERYKNECREKERE............................................................................ 118
40 -21.0003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  13  1......................................SNAMAKNDKINFSTP-SGFPEFLPSEKRLELYLLDTIRRVYESGFTPIETPAVERLEVLQAKGNQGDNIPPNRQAEKDKSGDTGSEARALKFDQTVPLAAYIARHLNDLT-FPFARYQMDVVFRGERAKD-----RFRQFRQCDIDVVGREKLSLLYDA-QMPAIITEIFEAVNIGDFVIRINNRSELETVITGVRNLGVPDKRFCIDLAIARGLNYYTGTVYETTLIGHEALGS---ICSGGRYEELVGTFLISRLLKAGILNTLPPTPAQVVVVNM-----QDELMPTYLKVSQQLRQAGLNVITNFEKRQLGKQFQAADKQGIRFCVIIGADEAAAQKSSLKDLQSGEQVEVALADLAEEIKRRLT........................................................................................ 465
41 -20.7004rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  16  6...................................................RAVRGTKDLFGKELRMHQRIVATARKVLEAGALELVTPIFEETQVFEKGVGA-DIVRKEMFTFQ----DRGGRSLTLRPEGTAAMVRAYLEHGMKVWPQPVRLWMAGPMFRAERPQK-----RYRQFHQVNYEALGSENPILDAE---AVVLLYECLKELGLRRLKVKVRPMLDFLGEEARAHLKEVERHLERLSVPYELELDYYVRTAFEVHHEEIGAQSALGGGGRYGLSELLGGPRVPGVGFAFGVFGLPEEKGPDLYLIPL-----TEEAVAEAFYLAEALRP-RLRAEYALAPRKPAKGLEEALKRGAAFAGFLGEDELRAGEVTLKRLATGEQVRLSREEVPGYLLQALG........................................................................................ 423
42 -20.7005e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  12  7...................................................VAIKGFNDVLPTQTAAWRRLEQHLASLMDAGYQQIRLPIVEQTGLFKRAIGDATDIEKEMYTFFDKGNP--PESLTLRPEGTAGCVRALVEH-NLLRGATPRVWYMGPMFRYEKPQK-----RYRQFHQFGVETFGVATPDIDAE---LIMLTARLWKRMGVDKILENAPKLHDFLKEDSLSHFQQLQDYLTAAGIKFVINLDYYNKTVFEWTTTALGSQGTVCAGGRYDGLVGQLKGKADQSVPAVGFAMGME-VRDCEAFLVA-----EPAYQSKALVLAEQLRDQLEAANSNGSQGSMKSQMKKADQAGAVYAIILGEREWEAQQLAVKELATAEQSQVALAELVPFLIEKFTK....................................................................................... 432
43 -20.3004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  14  68...................................................KTPKGTRDYSPRQMAVREKVFDVIIRCFKRGAEVIDTPVFELKETLMGKYGE----SKLIYDLK----DQGGELLSLRY-----LTVPFARYLAMNKLTNIKRYHIAKVYRRDNPAMTRG--RYREFYQCDFDIAGNFDPMIPD--AECLKIMCEILSSLQIGDFLVKVNDRRNKQALEGLGDLKLLFEYLTLFGIDDKISFDLSLARGLDTPAQAGEEPLGVGSVAAGGRYDGLVGMFDPKGRKVPCVGLSIGVERIFSIVTQVLVASAQKKLLEERLKLVSELWDAGIKAELLKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQ....................................................................................... 515
44 -20.3004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  14  15...................................................KTPKGTRDYSPRQMAVREKVFDVIIRCFKRGAEVIDTPVFELKETLMGKYGE----SKLIYDLK----DQGGELLSLRY-----LTVPFARYLAMNKLTNIKRYHIAKVYRRDNPAMTRG--RYREFYQCDFDIAGNFDPMIPD--AECLKIMCEILSSLQIGDFLVKVNDRRNKQALEGLGDLKLLFEYLTLFGIDDKISFDLSLARGLDTPAQAGEEPLGVGSVAAGGRYDGLVGMFDPKGRKVPCVGLSIGVERIFSIVTQVLVASAQKKLLEERLKLVSELWDAGIKAELLKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQ....................................................................................... 462
45 -20.1003vbb_A mol:protein length:522 Seryl-tRNA synthetase, cytoplasmic  ali model follow..  15  160............................GDCTVRKKYSHDLVVMVDGFEGEKAGSRGYFLKGVLVFLEQALIQYLRTLGSRGYIPIYTPFFMRKEVM-QEVAQLSQFDEELYKVIGKGSEKSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQEVGSHTRGIFRVHQFEKIEQFVYSPHDNKSWEMFEEMITTAEEFYQSLGIPYHIVNIVSGSLNHAASKKLDLEAWFPGSGA-ELVSCSNCTDYQARRLRIRYGQTKKMMDHMLNATMCATTRTICAILENYQTEKGITVPEKLKEFMPPGLQELIPFVKPAPIEQEPSKKQKKQHEGSKKKAAARDVTLENRLQNMEVT..................................................................................................................................... 512
46 -20.0003w3s_A mol:protein length:527 Type-2 serine--tRNA ligase  ali model follow..  16  187............................PRRIRFRGDVTEEARRRGWVK-EFPGRGQWIYTPPMAALFEVLRDFLLERVKLGFEPALFPKLIPLETM-FRMRYLHGLPDGMYYVCPPKRDPEDPGYVLAPAQCEPFYELLRDEVVDPERLPIKLYDCGWTYRWEGGAAKG-LERVNEFQRIE--VWIAEPEEAYRIRRELLEATKRVAEELELEWKVVVSDDRDIELPDVPSYEFEVYLPFKGEISVGSFNVHGEHFVDGFNVK--EKSGRTLFTGCAGLGV-TRWVVGLLAQHGFYPY-EWPEPI............................................................................................................................................................................................. 505
47 -19.8002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  15  4..........................................YQDPMAKNIQAIRGMNDYLPGETAIWQRIEGTLKNVLGSGYSEIRLPIVEQTPLFKRAIGEVTDVEKEMYTFE----DRNGDSLTLRPEGTAGCVRAGIEH-GLLYNQEQRLWYIGPMFRHERPQK-----RYRQFHQLGCEVFGLQGPDIDAE---LIMLTARWWRALGISALLNDAPALGDYLDEESREHFAGLCKLLESAGIAYTVNLDYYNRTVFEWVTNSLGSQGTVCAGGRYGLVEQLGGRATPAVGFAMGLPEFKADPVVDIYLVAS-----GADTQSAAMALAERLRDPGVKLMTNHGGGNFKKQFARADKWGARVAVVLGESEVANGTAVVKDLRSGEQTAVAQDSVAAHLRTLLG........................................................................................ 431
48 -19.5001ser_A mol:protein length:421 PROTEIN (SERYL-TRNA SYNTHETASE (E.C.6.1.1.11))  ali model follow..  16  126............................PPEFSFPPLDHVALMEKNGWWEPRSGSRSYALKGDLALYELALLRFMDFMARRGFLPMTLPSYAREKAF-LGTGHFPAYRDQVWAI-------AETDLYLTGTAEVVLNALHSGEILPYEALPLRYAGYAPAFRSEAGSDVRGLMRVHQFHKVEQYVL--SLEASDRAFQELLENAEEILRLLELPYRLVEVATGDMGPGKWRQVDIEVYLPSEGR-ETHSCSALLDWQARRANLRYRDPEGRVRYAYTLN--ATPRILAMLLENHQLQDGVRVPQALIPY.......................................................................................................................................................................................... 411
49 -19.2002dq3_A mol:protein length:425 Seryl-tRNA synthetase  ali model follow..  18  130...........................EPRKFDFEPKPHEIGERLGILDFKRSGSRFTVIAGWGARLERALINFLDLHTKKGYKEICPPHLVKPEIL-IGTGQLPKFEEDLYKCE-------RDNLYLIPTAEVPLTNLYREEILKEENLPIYLTAYTPCYRREAGADIRGIIRQHQFDKVELVKI-VHPDTSYDELEKLVKDAEEVLQLLGLPYRVVELCTGDLGFSAAKTYDIEVWFPSQNK-EISSCSNCEDFQARRMNTRFKDSKTGKNRFVHTLNGAVGRTLAAILENYQQEDGVVVPEVLRDY.......................................................................................................................................................................................... 416
50 -18.7002dq0_A mol:protein length:455 Seryl-tRNA synthetase  ali model follow..  18  124VPIRFWGKARVWKGHLERFLEQSQGKMEYEILEWKPKLHDLLEILGGADFARSGSRFYYLLNEIVILDLALIRFLDRLIEKGFTPVIPPYMVRRFVE-EGSTSFEDFEDVIYKV-------EDEDLYLIPTAEHPLAGMHANEILDGKDLPLLYVGVSPCFRKEAGTATKGIFRVHQFHKVEQFVY-SRPEESWEWHEKIIRNAEELFQELEIPYRVVNICTGDLGYVAAKKYDIEAWMPGQGK-EVVSASNCTDWQARRLNIRFRDRTDEKPRYVHTLNSATSRAIVAILENHQEEDGVRIPKVLWKY.......................................................................................................................................................................................... 437
51 -18.6003err_A mol:protein length:536 fusion protein of microtubule binding domain from mouse cytoplasmic dynein and seryl-tRNA synthetase from Thermus thermophilus  ali model follow..  17  234...........................GPPEFSFPPLDHVALMEKGWWEPR-SGSRSYALKGDLALYELALLRFMDFMARRGFLPMTLPSYAREKAF-LGTGHFPAYRDQVWAI-------AETDLYLTGTAEVVLNALHSGEILPYEALPLRYAGYAPAFRSEAGSDVRGLMRVHQFHKVEQYVL-ASLEASDRAFQELLENAEEILRLLELPYRLVEVATGDMGPGKWRQVDIEVYLPSEGR-ETHSCSALLDWQARRANLRYRDPEGRVRYAYTLN--ATPRILAMLLENHQLQDGVRVPQALIPY.......................................................................................................................................................................................... 520
52 -18.5001wle_A mol:protein length:501 Seryl-tRNA synthetase  ali model follow..  15  171...........................DKPAFSFQPRGHEIAEKLDIIRQKRSGHRSYYLRGAGALLQHGLVNFLNKLIHRGFTPMTVPDLLRGVVF-EGCGMTPNAKPSQIYNI---DPSRFEDLNLAGTAEVGLAGYFMDHSVAFRDLPIRMVCSSTCYRAETDTEPWGLYRVHHFTKVEMFGV--GLEQSSELLEEFLSLQMEILTELGLHFRVLDMPTQELGLPAYRKFDIEAWMPGRGR-EVTSASNCTDFQSRRLHIMFQTEAGELQFAHTVN--AVPRLLIALLESYQQKDGVLVPPALQPY.......................................................................................................................................................................................... 461
53 -18.4003lsq_A mol:protein length:484 Seryl-tRNA synthetase  ali model follow..  14  166...........................GNTTKRAKLNHVSIMERGMMDTSKAAGGRSYVLKGGLVQLQVALVSYLDFLVKRGYTPFYPPFFLNRDVM-GEVAQLSQFDEELYQV-----SGDGDKKYLIATSEMPIAAYHRGRWFTELKEPLKYAGMSTCFRKEAGAHTLGIFRVHQFDKIEQFVV-PRQEESWRHLEDMITTSEEFNKSLGLPYRVVNICSGALNNAAAKKYDLEAWFPASGA-ELVSCSNCTDYQSQSVNCRYGPNLRGTAHMLNGTLCAITRTMCCICENYQTEEGVVIPDVLRPY.......................................................................................................................................................................................... 460
54 -18.1004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  15  4............................GTLEAQTQGPGSMTEQKRKLEKLTGVKGMNDILPQDAGLWEFFEATVKSLLRAGYQNIRTPIVEHTPLFTRGIGE-DIVEKEMYSFV---DALNGENLTLRPENTAAVVRAAIEH-NMLYDGPKRLWYIGPMFRHERPQR-----RYRQFHQVGVEALGFAGPDADAE---IVMMCQRLWEDLGLTEIVRNAPKLIDFLGDVSRAHFEGLQRLLKANNVPFTINLDYYNLTVFEWVTDKLGAQGTVAAGGRYDPLIEQLGG-ILELLKEEHLV--PEQEGVDVYVVHQ-----GDAAREQAFIVAERLRDTGLDVILDGAGASFKSQMKRADASGAAFAVIFGEDEVTNGTASVKDGEKSVQQSVPVESLTEFLINAMVATAED................................................................................... 458
55 -18.0002lw7_A mol:protein length:170 Histidine--tRNA ligase, cytoplasmic  ali model follow..  20  68..................................................................................................................................................................................................................................................................................................................TETQVLVASA-----QKKLLEERLKLVSELQDAGIKAELLKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQ....................................................................................... 165
56 -18.0006blj_A mol:protein length:485 Serine-tRNA ligase  ali model follow..  13  174...........................VDPETGYKCLKHDIMRKLGGLATEEGGGRGYFLLGDLVRMNLALQNYIDFLAKKGYMPIYTPFFMTKEQM-KKVAQLSQFDEELYTV-----TGEGEDKYLIATSEQPIAAFHLEKRFDESELPIKYCGMSTCFRKEVGAHTLGIFRVHQFEKIEQFVV--KDNKSWEMFDEMIGNSEAFYQSLGIPYRVVNIVSGALNNAAAKKFDLEAWFPGADE-ELVSCSNCTDYQTRRLEVKYKKQGSEVEFCHMLN--ATSRTLCCIVENYQTPEGVNVPEVLQPY.......................................................................................................................................................................................... 468
57 -15.9004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  15  2.............PALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDGFLEIKSPILIPLEYIERMGIDNDT-------ELSKQIFRVDKNFCLRPMLAPNLANYLRKLDRALPD-PIKIFEIGPCYRKESDGK-----HLEEFTMLNFCQM-----GSGCTRENLESIITDFLNHLGIDFKIVGDS.................................................................................................................................................................................................................................................................................. 194
58 -15.8003od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  12  11...................................................EKPFGMRDTLPEWYKTKKNICDQMTEEINLGYDMIETPTLEYYETVGVVSAILD---QQLFKLL----DQQGNTLVLRPDMTAPIARLVASSLKD-RAYPLRLAYQSNVYRAQQNEG-----KPAEFEQLGVELIGDGTASADGE---VIALMIAALKRAGLSAIEEARGLIQTEKGKTALAEMTKLYEVLESYGASEYVKFDLTLVLHMSVVFE--SGGRYDELLSKFHRPAQATGFGVRIDLLVEALNGEIISNGHEQTCILF-----SNERRFEAIELARKKRANGEAVVLQDLAGVTDVDAMSSNYQDVIYCIGTAGRGGEDA..................................................................................................................... 400
59 -15.4005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  16  2.............PALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDGFLEIKSPILIPLEYIERMGI-------DNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPD-PIKIFEIGPCYRKESDGK----EHLEEFTMLAFAQM-----GSGCTRENLESIITDFLNHLGIDFKIVGDS.................................................................................................................................................................................................................................................................................. 194
60 -14.7004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  16  23.................KSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDGFLEIKSPILIPLEYIERMGI-------DNDTELSKQIFRVDKNFCLRPMLAPNLGNYLRKLDRALPD-PIKIFEIGPCYRKESDGK----EHLEEFTMLNFCQM-----GSGCTRENLESIITDFLNHLGIDFKI...................................................................................................................................................................................................................................................................................... 207
61 -14.6003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  15  15............APALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDGFLEIKSPILIPLEYIERMGIDNDT-------ELSKQIFRVDKNFCLRPMLTPNLYNYLRKLDRALPD-PIKIFEIGPCYRKESDGK----EHLEEFTMLVFWQM-----GSGCTRENLESIITDFLNHLGIDFKIVGDS.................................................................................................................................................................................................................................................................................. 208
62 -14.3004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  14  2..............ALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEEGKLEREITRFFVD---RGFLEIKSPIL-------IPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMVAPNIFNYARKLDRALPD-PIKIFEIGPCYRKESDGK----EHLEEFTMLNFFQM-----GSGCTRENLESIITDFLNHLGIDFKIVGDS.................................................................................................................................................................................................................................................................................. 193
63 -13.9002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  14  23PLSSFWTKVQYQRLKELNASGEQLEMGFSDALSRDRAFQGIEHQLMSQGKRHL----QLRTVKHRPALLELEEKLAKALHQGFVQVVTPTIITKSALAKMTI-------GEDHPLFSQVFWLDGKKCLRPMLAPNLYTLWRELERLW-DKPIRIFEIGTCYRKESQGA----QHLNEFTMLNLTELGTPLEERHQRLE---DMARWVLEAAGIREFELVTESSV............................................................................................................................................................................................................................................................................... 229
64 -12.7002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  16  14HMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRR-------------IYAEERENYLGKLEREITRFFDRGFLEIKSPILIPLEYIERMGI-------DNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPD-PIKIFEIGPCYRKESDGK----EHLEEFTMLNFCQM-----GSGCTRENLESIITDFLNHLGIDFKIVGDS.................................................................................................................................................................................................................................................................................. 211
65 -11.6003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  12  1............................SNAMNGTRSAWGARAWEAVRGFADRPPGMQDGYPDFAKRRRAVETRLLSFVEDGYEPVTSGLFEYVDTLLRARS--PESSRDWIRLF----DGGGDAVALRPEMTPSIARMAAPRVAA-GRTPIRWCYCERVYRRTDDPASLSWASGKAAESTQVGIERIGEEASVDVDMDVLRLLHEASAAAGVRHHRIVVSHARLVPRASLSRAFLACLTSGNYVQFRELWQLHAAKDVDLLANLLTWSPAERDAAKRSREASDRELEALLRDAVD-------------------PRAAADVRDAWRYLCRLAEALHDSGLVVTFDLADYYTGLVF-EMFAPGVGAPIAQGGR-------ELLAQFGAGAPAVGFAFEVERVMAVLEAQEE.................................................................................... 368
66 -11.5004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  18  65..........................................................IYAEERENYLGKLEREITRFFDRGFLEIKSPILIPLEYIERMGIDNDT--------LSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPD-PIKIFEIGPCYRKESDGK----EHLEEFTMLSFIQM-----GSGCTRENLESIITDFLNHLGIDFKIVGDS.................................................................................................................................................................................................................................................................................. 211
67 -9.6906FTT Entity 1(prereleased)  ali follow..  5......................................................DGVADVLFEDAHKQEVLRHQLTQQLITGYQLVSPPMIEFTESLLSGAS--EDLKRQTFKII---DQLTGRLMGIRA---DITPQILRIDAHHGGDGIARYCYAGDVIHTLPSGL-----GSRTPLQLGAEIFGCESIAADIE---LIDVLFSMINSLDMSAVLHVDLGHVTIFKR-----------------LAELAALSASDTEQL-MQLYANKNLPELKQVCQVLPMGSDFYTLARFGHDIANL--------LGRLSENAQQDTKIVTAIDELQRLKAHLQVQWCAVSIDVTHYHTGIVF-NGYINSETQPLVRGGRGMKSNQLATNQPRQATGFSMDVSRLLAHTQLD-SAQRQLLLQQVASLRQQGYRVTMPLTAEDMPVGLTHRLSLA................................................ 379
68 -9.6905m8h_A mol:protein length:388 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  5......................................................DGVADVLFEDAHKQEVLRHQLTQQLITGYQLVSPPMIEFTESLLSGAS--EDLKRQTFKII---DQLTGRLMGIRA---DITPQILRIDAHHGGDGIARYCYAGDVIHTLPSGL-----GSRTPLQLGAEIFGCESIAADIE---LIDVLFSMINSLDMSAVLHVDLGHVTIFKR-----------------LAELAALSASDTEQL-MQLYANKNLPELKQVCQVLPMGSDFYTLARFGHDIANL--------LGRLSENAQQDTKIVTAIDELQRLKAHLQVQWCAVSIDVTHYHTGIVF-NGYINSETQPLVRGGRGMKSNQLATNQPRQATGFSMDVSRLLAHTQLD-SAQRQLLLQQVASLRQQGYRVTMPLTAEDMPVGLTHRLSLA................................................ 379
69 -9.5701z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  10  20......................................................EESAEMTLNQVKSLRQIEGRLRKLFSLNYQEVMPPSFEYTQLYTALESNGKTFQEKMFQFI----KHEGQSITLRY---DFTLPLVRLYSQIKDSTSARYSYFGKIFRKEKRHK-----RSTENYQIGIELFGESADKSELE---ILSLALQVIEQLGLNKTVFEIGSAKFFQR---------------------LCQLADGSTELLTELLLKKDLSGLNAFIEKNNFSKELRGLLKEIFITNE------------SRLENLVTNTKDDVLISSFDQLKEFSEKLSMPIIIDLGDYYTDLMF-KAYSSAANQPILSGGR-------QLLSNFQEEAFAIGFCCHMDTILKALERQELE................................................................................... 334
70 -9.0703g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  13  22.................................................................AIMAEIRRFFAD---RGVLEVETPCMSQATV---TDIHLFPFETRF----VGPGHSQGINLYLMTSPEYHMKRLLAAGCG-------PVFQLCRSFRNEEMGRHH----NPEFTMLEWYRPHYDMYRLMNEVD---DLLQQVLDCQPAESLSYQQAFQRHLEIDPLSADKTQLREAAAKLDLSNIADTEEDRDTLLQLLFTMG-GKEKPTFIYHFPAS---QASLAQISTED-----HRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQQPIDQNLLDALAAGLPVMLALGAESLAD...................................................................................................................... 317

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 4 5 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.