current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 1nj8_A mol:protein length:459 Proline-tRNA Synthetase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .
# Score Template Links and tools%idFirst GSHMLEFSEWYSDILEKAEIYDVRYPIKGCGVYLPYGFKIRRYTFEIIRNLLDESGHDEALFPMLIPEDLLAKEAEHIKGFEDEVYWVTHGGKTQLDVKLALRPTSETPIYYMMKLWVKVHTDLPIKIYQIVNTFRYETKHTRPLIRLREIMTFKEAHTAHSTKEEAENQVKEAISIYKKFFDTLGIPYLISKRPEWDKFPGAEYTMAFDTIFPDGRTMQIATVHNLGQNFSKTFEIIFETPTGDKDYAYQTCYGISDRVIASIIAIHGDEKGLILPPIVAPIQVVIVPLIFKGKEDIVMEKAKEIYEKLKGKFRVHIDDRDIRPGRKFNDWEIKGVPLRIEVGPKDIENKKITLFRRDTMEKFQVDETQLMEVVEKTLNNIMENIKNRAWEKFENFITILEDINPDEIKNILSEKRGVILVPFKEEIYNEELEEKVEATILGETEYKGNKYIAIAKTYLast
1 -164.0001nj8_A mol:protein length:459 Proline-tRNA Synthetase  ali model  100  1GSHMLEFSEWYSDILEKAEIYDVRYPIKGCGVYLPYGFKIRRYTFEIIRNLLDESGHDEALFPMLIPEDLLAKEAEHIKGFEDEVYWVTHGGKTQLDVKLALRPTSETPIYYMMKLWVKVHTDLPIKIYQIVNTFRYETKHTRPLIRLREIMTFKEAHTAHSTKEEAENQVKEAISIYKKFFDTLGIPYLISKRPEWDKFPGAEYTMAFDTIFPDGRTMQIATVHNLGQNFSKTFEIIFETPTGDKDYAYQTCYGISDRVIASIIAIHGDEKGLILPPIVAPIQVVIVPLIFKGKEDIVMEKAKEIYEKLKGKFRVHIDDRDIRPGRKFNDWEIKGVPLRIEVGPKDIENKKITLFRRDTMEKFQVDETQLMEVVEKTLNNIMENIKNRAWEKFENFITILEDINPDEIKNILSEKRGVILVPFKEEIYNEELEEKVEATILGETEYKGNKYIAIAKTY 459
2 -128.0001nj1_A mol:protein length:501 Proline-tRNA Synthetase  ali model follow..  58  28GEKMTEFSEWFHNILEEAEIIDQRYPVKGMHVWMPHGFMIRKNTLKILRRILDR-DHEEVLFPLLVPEDELAKEAIHVKGFEDEVYWVTHGGLSKLQRKLALRPTSETVMYPMFALWVRSHTDLPMRFYQVVNTFRYETKHTRPLIRVREITTFKEAHTIHATASEAEEQVERAVEIYKEFFNSLGIPYLITRRPPWDKFPGSEYTVAFDTLMPDGKTLQIGTVHNLGQTFARTFEIKFETPEGDHEYVHQTCYGLSDRVIASVIAIHGDESGLCLPPDVAAHQVVIVPIIFKKAAEEVMEACRELRSRLAAGFRVHLDDRDIRAGRKYYEWEMRGVPLRVEIGPRDLEKGAAVISRRDTGEKVTADLQGIEETLRELMKDILENLRTRAWERMESEIREAETL--EEASRIVDEKRGIISFMWCGEEECGMDVEEVRVDILGIQEEGSGTCINCGRTY 495
3 -125.0003ial_A mol:protein length:518 Prolyl-tRNA synthetase  ali model follow..  39  12TKTRDTFADWFDAIMDAAELVDRRYPVKGCVVFRPYGFFMENAIMRLCEEEYAKVGISQILFPTVIPESFLKKESDHIKGFEAECFWVEKGGLQPLEERLALRPTSETAIYSMFSKWVRSYKDLPLKIHQTCTIFRHETKNTKPLIRVREIH-WNEAHCCHATAEDAVSQLSDYWKVIDTIFSDELFKGQKLRRVCWDRFPGADYSEVSDVVMPCGRVLQTAGIHNLGQRFSSTFDILYANKANESVHPYLTCAGISTRVLACALSIHGDSGGLVLPPLIAPIHVVIIPIGCGKKNQQVLGKVNEIADTLKLGLRVSIDDDSKSMGDKLYYYELKGVPLRIEVGQRDLANGQCIVVPRDVGKDQKIPITEVMKVSSDELDAYKARLKEKAFAFHNSMVTNCKSF--DEIVACIENKGGLARFPFYTTEADGEVWDKCSAEIRGHNPDEGEVCALSGKSY 512
4 -122.0004k86_A mol:protein length:535 Proline--tRNA ligase  ali model follow..  33  35AKKEENLADWYSQVITKSEMIEY-HDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFLRTREFL-WQEGHSAFATMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEKEKGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNAEALIAKCNDYRRRLLSVNIRVRADLRNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILEDIQVTLFTRASEDLKTHMVVANTM--EDFQKIL-DSGKIVQIPFCGEIDCEDWIKKTGAKSLCIPFKPGAKCVCGGRSY 529
5 -120.0005xip_A mol:protein length:498 Prolyl-tRNA synthetase, putative  ali model follow..  33  7AKKSTNFADWYTQVIVRGELVE-YYDISGCYIIRPWAYRIWEAVQKFFDDGIKRLGVENCYFPMFVSQAKLEKEKDHVEGFKPEVAWVTHYGDSELPEKVAIRPTSETIMYPAYAKWIRSHRDLPLKLNQWNNVVRWEFKQPTPFLRTREFL-WQEGHTAHATEEEAYTLVLEILELYRQWYEDYLAVPVIKGEKSENEKFAGGKKTTTIEGIDTGRGIQAATSHLLGQNFSRMFSIEFEDEKGAKQLVHQTSWGCTTRSLGVMIMTHGDDKGLVLPPRVVAVQAVIIPIIFKETGGIVAKCRELERLLNAAGVRVKVDDRNYTPGWKFNDWELKGVPLRLEIGPRDVESCQTRVVRRDTSEARNVPWAEAASTIPAMLETMQKDLFNKAKAKFEASIEQITTF--DEVMPAL-NRRHVVLAPWCEDPETETQIKREAMKPLCIPFDQGTRCFFTGRSY 498
6 -119.0005xif_A mol:protein length:500 Prolyl-tRNA synthetase (ProRS)  ali model follow..  34  6AKKDENFSEWYTQAIVRSEMIE-YYDISGCYIMRPWAFHIWEKVQRFFDDEIKKMGVENSYFPMFVSRHKLEKEKDHVEGFSPEVAWVTHYGDSPLPEKIAIRPTSETIMYPAYAKWIRSHRDLPLKLNQWCSVVRWEFKQPTPFLRTREFL-WQEGHTAHATEEEAWELVLDILELYRRWYEECLAVPVIKGEKSEGEKGGKKTTTVEAFIPENGRGIQAATSHLLGTNFAKMFEIEFEDEEGHKRLVHQTSWGCTTRSLGVMIMTHGDDKGLVIPPRVASVQVVIIPILFKDENGEILGKCRELKTMLKADIRVRIDDRNYTPGWKYNHWEVKGVPLRLELGPKDLAKGTARVVRRDTGEAYQISWADLAPKLLELMEGIQRSLFEKAKARLHEGIEKISTF--DEVMPAL-NRKHLVLAPWCEDPESEEQIKKEAMKTLCIPFDQGTKCFYTGRSY 500
7 -119.0004hvc_A mol:protein length:519 Bifunctional glutamate/proline--tRNA ligase  ali model follow..  33  19AKKEENLADWYSQVITKSEMIEY-HDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFLRTREFL-WQEGHSAFATMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEKEKGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFANSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNAKEALIAKCNDYRRRLSVNIRVRADLRNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILEDIQVTLFTRASEDLKTHMVVANTM--EDFQKIL-DSGKIVQIPFCGEIDCEDWIKKTGAKSLCIPFKPGAKCVCGKRSY 513
8 -119.0004ncx_A mol:protein length:506 Proline--tRNA ligase  ali model follow..  33  10SKKIENFSDWYTQVIVKSELIE-YYDISGCYILRPAAYYIWECVQAFFNKEIKKLNVENSYFPLFVTKNKLEKEKNHIEGFSPEVAWVTKYGDSNLPEEIAIRPTSETIMYSVFPKWIRSYRDLPLKLNQWNTVVRWEFKQPTPFIRTREFL-WQEGHTAHKNEEEAVKLVFDILDLYRRWYEEYLAPIIKGIKSEGEKFGGANFTSTAEAFIENGRAIQAATSHYLGTNFAKMFKIEFEDENEVKQYVHQTSWGCTTRSIGIMIMTHGDDKGLVLPPNVSKYKVVIVPIFYKTTDEAIHSYCKDIEKILNAQINCVYDDRSYSPGYKFNHWELRGIPIRIEVGPKDLQNNSCVIVRRDNNEKCNVKKESVLLETQQMLVDIHKNLFLKAKKKLDDSIVQVTSF--SEVMNAL-NKKKMVLAPWCEDIATEEEIKKEAMKPLCIPLDQNMKCFWSGRSY 500
9 -115.0005f9y_A mol:protein length:511 Aminoacyl-tRNA synthetase  ali model follow..  35  14ADKITSFADWYSQVIVKSEMIEY-YDISGCYILRPWSYFIWETIQSVFDQKIKQHDVQNAYFPIFVTQKKLETEKDHVEGFSPEVAWVTKSGKSDLAEPIAIRPTSETIMYPYFAKWIRSHRDLPLKINQWTSIVRWEFKHPTPFIRTREFL-WQEGHTAHSTRKEALEMVDIILNEYASIYEDLATPVVKGTKSENEKFPGGDITKSIEGFIEIGRAVQAATSHLLGQNFSKMFGVEFEDEKGNKEYAHQTSWGLTTRAIGVMIMTHGDNKGLVLPPKVAPVQVIIIPIIFKTVIEEQKKICNEVECILKAGVRVKIDDRNYTPGWKYNHWEVKGVCLRFEVGPRDIEKRSVRVVVRDNMEKMDIPISELESKIPKLLEEFQNRLLFKAKQRQNESIIRVDTF--DKVMDTL-NQKKMVIAPWCEDVSCEEEIKKEAMKSLCIPNDQKTKCFFCDRSY 505
10 -110.0001h4q_A mol:protein length:477 PROLYL-TRNA SYNTHETASE  ali model follow..  36  8TPQSQDFSEWYLEVIQKAELAD-YGPVRGTIVVRPYGYAIWENIQQVLDRMFKETGHQNAYFPLFIPMSFLRKEAEHVEGFSPELAVVTHAGGEELEEPLAVRPTSETVIGYMWSKWIRSWRDLPQLLNQWGNVVRWEMRTR-PFLRTSEFL-WQEGHTAHATREEAEEEVRRMLSIYARLAREYAAPVIEGLKTEKEKFAGAVYTTTIEALMKDGKALQAGTSHYLGENFARAFDIKFQDRDLQVKYVHTTSWGLSWRFIGAIIMTHGDDRGLVLPPRLAPIQVVIVPIYKDESRERVLEAAQGLRQALAQGLRVHLDDRQHTPGYKFHEWELKGVPFRVELGPKDLEGGQAVLASRLGGKE-TLPLAALPEALPGKLDAFHEELYRRALAFREDHTRKVDTY--EAFKEAVQE--GFALAFHCGDKACERLIQETTATTRCVPEPEEGFCVRCGKAY 477
11 -105.0005xil_A mol:protein length:512 Putative prolyl-tRNA synthetase  ali model follow..  30  7AKREENFSAWYIDVITKAEMIE-YYDVSGCYIIRPWAYYVWKCVQRFLGGKIEKLGVEDCYFPMFVSRSCLEREKDHIEGFAPEVAWVTRAGDTELEQPVAVRPTSETVMYPYYAKWIRSHRDLPVRLNMWNNVIRWEFSHPTPFIRTREFL-WQEGHCAWAKAEECAKEVLEILECYASVYEQLLAPVVRGRKTEKEKFAGGDYTTTVETFIAVGRGCQGATSHNLGQNFGKMFDIRFQDPENNEQTLIPNSWGLSTRVIGVMIMVHGDNRGMVMPPRVASTQVIIIPVGITKDTQELLASCWRLESELEGGVRARCDLRNYSPGWRFNHWEVKGVPLRVELGPRELAERSLAVAVRHSGARHSVAWDAQTPAAAALLEDVHAQMYARAKETMETHRVRVTEW--TEFVPTL-NRKCLILAPWCGAMECENQVKKDGAKTLCIPFEQECICKGCTRSY 512
12 -89.6002j3l_A mol:protein length:572 PROLYL-TRNA SYNTHETASE  ali model follow..  20  13.EVPNDAEVLSHQILLRAGYI--RQVAAGIYSYLPLANRVLEKLKTIMREEFEKIDAVEMLMPALLPAELWKESGRYETYGPNLYRL-----KDRNDRDYILGPTHEETFTELIRDEINSYKRLPLNLYQIQTKYRDEKRSRSGLLRGREFIM-KDGYSFHADEASLDQSYRDYEKAYSRIFERCGLEFRAIIGDGGAMGGKDSKEFMAISEIGEDKGIEIGHIFKLGTRYSDAMGATVLDENGREKSVIMGCYGIGVRLLSAIVEQNADERGINWPTGIAPFDLHVVQMNVKDE-YQTKLSQEVEAMMTEAGYEVLVDDRNERAGVKFADADLIGCPIRITVGKKAVD-GVVEVKIKRTGEMLEVRKEELESTLSILMNTTSEV.......................................................................... 571
13 -80.6002i4l_A mol:protein length:458 Proline-tRNA ligase  ali model follow..  20  27.ENPKEAEIVSHRLMLRAGML--RQEAAGIYAWLPLGHRVLKKIEQIVREEQNRAGAIELLMPTLQLADLWRESGRYDAYGPE-----MLRIADRHKRELLYGPTNEEMITEIFRAYIKSYKSLPLNLYHIQWKFRDEQRPRFGVMRGREFL-MKDAYSFDVDEAGARKSYNKMFVAYLRTFARMGLKAIPMRAETGPIGGDLSHEFIVLAETGESRGIEVGQIFYFGTKYSDSMKANVTGPDGTDAPIHGGSYGVGVRLLGAIIEACHDDNGIIWPEAVAPFRVTILNLKQGDA-ATDAACDQLYRELSAKGVDVLYDDTDQRAGAKFATADLIGIPWQIHVGPRGLAEGKVELKRRSDGARENLALADVVARLT................................................................................... 452
14 -78.6005ucm_A mol:protein length:579 Proline--tRNA ligase  ali model follow..  23  15.ETPADAVVISHQLLLRAGMI--RRLASGLYTWLPMGLRVLRKVETIVREEMNAAGALEVLMPAVQPAELWQESGRWEQYGPELLRL-----KDRHEREFCVGPTHEEVITDLARNELNSYKQLPINFYQIQTKFRDEIRPRFGLMRGREFIM-KDAYSFHLSQDSLQQTYDGMYQAYSKIFSRLGLDFRPVQADNGSIGGSGSHEFHVLANSGEDRGIEVGHIFQLGTKYSEAMKLSVLSEQGKPVNLIMGCYGIGVRVVAAAIEQNHDERGILWPSALAPFQIALVPLKYETE-SVKQATDKLYAELTAAGFEVLLDDRDKSPGVKFADMELIGIPHRIVISDRGLSEGVLEYKGRRDSESQNLPIGELMSFITEKLSR.............................................................................. 573
15 -67.2004p3n_A mol:protein length:415 Threonine--tRNA ligase, cytoplasmic  ali model follow..  16  2...GSSSSGDHRKIGRDQELYFFHELSPGSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTSG-HWQHYSENMFSF-----EVEKELFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGALTGLTRVRRFQQDDAHIFC-AMEQIEDEIKGCLDFLRTVYSVFGFSFKLNLSTRPEKFGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCDE----YAQKVRQQFHDAKFMADIDDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERTISETIERLQQLKEFRSKQAEEE...................................................................... 408
16 -65.5004hwt_A mol:protein length:413 Threonine--tRNA ligase, cytoplasmic  ali model follow..  16  1......MARDHRKIGRDQELYFFHELSPGSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTSG-HWQHYSENMFSF-----EVEKELFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGALTGLTRVRRFQQDDAHIFC-AMEQIEDEIKGCLDFLRTVYSVFGFSFKLNLSTRPEKFGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCDE----YAQKVRQQFHDAKFMADIDDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERTISETIERLQQLKEFRSKQAEEEFLE................................................................... 407
17 -61.1004hwo_A mol:protein length:411 Threonine--tRNA ligase  ali model follow..  15  1......MARDHRKIGKQLDLYHMQEEAPGMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRVLWEKTG-HWDNYKDAMFTT-----SSENREYCIKPMNCPGHVQIFNQGLKSYRDLPLRMAEFGSCHRNEPSGSLHGLMRVRGFTQDDAHIFC-TEEQIRDEVNGCIRLVYDMYSTFGFEKIVVKLSTRPEEGAFYGPKIEFTLYDCLDRAWQCGTVQLDFSLPSRLSASYVGEDNERKVPVM-IHRAILGSMERFIGILTEEFAGFFPTWLAPVQVVIMNITDSQSE----YVNELTQKLSNAGIRVKADLRNEKIGFKIREHTLRRVPYMLVCGDKEVESGKVAVRTRRGKDLGSMDVNEVIEKLQQEIRSRSLKQLEE...................................................................... 403
18 -59.3003a31_A mol:protein length:471 Probable threonyl-tRNA synthetase 1  ali model follow..  13  14YELDITVKPDSRVPVFNREFATF--TGAGVPLFSLGGGPIRYALAEVLAKFHARRGYYVVETPIIASTELFKVSG-HIEFYRNNMYLF-----DIEGHEFAVKPMNCPYHILLFLNEVASKLPLPFKVFEFGRVHRYEPSGSIYGLLRVRGFTQDDAHIIV-PGGRVIDVVYDVFEEMKLVLERLFKGIDIVELEGEAAFYGPKLDFIMMVEESGVSKEWQMGTIQFDFNLPRRFRLYDVVREEFGIEEVYIIHRALLGSIERFLGVYLEHRRGRMPFTLAPIQFAVIAVKTGGEREIEDLASSIAKGLLDKGFRVAVKGSSKGLSSDVRHIESTAKPAVVFIGAKEVREKVLDVRVFDLESMKRRRLAIAYGDAADAVENLAAVA......................................................................... 446
19 -58.0003ugq_A mol:protein length:460 Threonyl-tRNA synthetase, mitochondrial  ali model follow..  14  24...SATPATMTSMVSQRQDLFMTDPLSPGSMFFLPNGAKIFNKLIEFMKLQQKKFGFNEVVTPLIYKKTLWEKSG-HWENYADDMFKVE--TTDEEKEEYGLKPMNCPGHCLIFGKKDRSYNELPLRFSDFSPLHRNEASGALSGLTRLRKFHQDDGHIFC-TPSQVKSEIFNSLKLIDIVYNKIFPFVKGGSGKLNPGDGAFYGPKLDIMVTDHLRKTHQVATIQLDFQLPERFDLKFKDQDNSYKRPIM-IHRATFGSIERFMALLIDSNEGRWPFWLNPYQAVIIPVNTKNVQNELEADDMEPVPLNDWHFNVDLDIRNEPVGYRIKSAILKNYSYLIIVGDEEVQLQKYNIRERDNRKSEKLTMSQIWEKFIELEKNYK............................................................................ 454
20 -57.8001nyq_A mol:protein length:645 threonyl-tRNA synthetase 1  ali model follow..  16  234.MLEERKERDHRKIGKELELFTNSQLVAGLPLWLPNGATIRREIERYIVDKEVSMGYDHVYTPVLANVDLYKTSG-HWDHYQEDMFPPM---QLDETESMVLRPMNCPHHMMIYANKPHSYRELPIRIAELGTMHRYEASGAVSGLQRVRGMTLNDSHIFV-RPDQIKEEFKRVVNMIIDVYKDFGFEDYSFRLSYRIGEAAFYGPKLDVQVKTAMGKEETLSTAQLDFLLPERFDLTYIGQDGEHHRPVV-IHRGVVSTMERFVAFLTEETKGAFPTWLAPKQVQIIPVNVDLHYDYARQLQDELK---SQGVRVSIDDRNEKMGYKIREAQMQKIPYQIVVGDKEVENNQVNVRQYGSQDQETVEKDEFIWNLVDEIRLKKHR.......................................................................... 645
21 -54.7001qf6_A mol:protein length:642 THREONYL-TRNA SYNTHETASE  ali model follow..  15  234QRLEEAAKRDHRKIGKQLDLYHMQEEAPGMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRVLWEKTG-HWDNYKDAMFTT-----SSENREYCIKPMNCPGHVQIFNQGLKSYRDLPLRMAEFGSCHRNEPSGSLHGLMRVRGFTQDDAHIFC-TEEQIRDEVNGCIRLVYDMYSTFGFEKIVVKLSTRPEEGAFYGPKIEFTLYDCLDRAWQCGTVQLDFSLPSRLSASYVGEDNERKVPVM-IHRAILGSMERFIGILTEEFAGFFPTWLAPVQVVIMNITDSQSE----YVNELTQKLSNAGIRVKADLRNEKIGFKIREHTLRRVPYMLVCGDKEVESGKVAVRTRRGKDLGSMDVNEVIEKLQQEIRSRSLKQLEE...................................................................... 642
22 -49.7001b76_A mol:protein length:442 Glycine--tRNA ligase  ali model follow..  16  2ASSLDELVALCKRRGFIFQSSEIYGGLQGVYDYGPLGVELKNNLKQAWWRRNERDDMEGLDASVLTHRLVLHYSG-HEATFADPMV-DLRGPRGGRGLLAYLRPETAQGIFVNFKNVLDATSKLGFGIAQIGKAFRNEITPRNFIFRVREF-EQMEIEYF-VRPGEDEYWHRYWVEERLKWWQEMGLSRENLVRTDFDLGSHTKDQEALGITARVLRNEHSTQRLAYRDPETGKWFVPYVIEPSAGVDRGVLAL-LAEAFTREELPNGEERIVLKLKPQLAPIKVAVIPLV-KNRPEITEYAKRLKARLLALGLGRVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSTVTVRDRDTMEQIRLHVDELEGFLRERLR............................................................................... 441
23 -39.1002cim_A mol:protein length:522 SERYL-TRNA SYNTHETASE  ali model follow..  18  189EPMEHPFKEDPTQAMMKEGWL-KRGSSRGQWIHGPQSARIFRTFEKIVLEELEPLGYREMIFPKLVTWEVWMKSG-HAKGVYPEIYYVCPPQTRDAEPIGGMCYAQCPPFWMYVAGETLPNEEIPVKVFDRGTSHRYESGGIHGIERVDEFHRIE---VWIGTKEEVLKCAEELHDRYMHIFNDILDIEWRKARVTPNTVGTTDYEACLPYRGPDGEWLEFQNVSINGDKYPKGFNVKLQSGD----ELWSGCSGVGLRWAAVFLAQKGLDPA-NWP---EEFRNRVGEMPK....................................................................................................................................................................... 511
24 -35.7001ati_A mol:protein length:505 GLYCYL-TRNA SYNTHETASE  ali model follow..  18  1...AASSLDELVALCKRRGFIEIYGGLQGVYDYGPLGVELKNNLKQAWWRRNERDDMEGLDASVLTHRLVLHYSG-HEATFADMMFQDLRGPRGGRGLLAYLRPETAQGIFVNFKNVLDATSKLGFGIAQIGKAFRNEITPRNFIFRVREF-EQMEIEYF-VRPGEDEYWHRYWVEERLKWWQEMGLSLVPYQQPPESSAHYAKATVDILYRFPHGSLELEGIAQRTDFDLGSHTKDQ-ETGKWFVPYVIEPSAGVDRGVLALLAEAFTREE-LKLKPQLAPIKVAVIPLV-KNRPEITEYAKRLKARLLALGLGRVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSTVTVRDRDTMEQIRLHVDELEGFLRERLR............................................................................... 504
25 -33.1002pme_A mol:protein length:693 Glycyl-tRNA synthetase  ali model follow..  15  60PKDDIVDRAKMEDTLKRRFFYAIYGGVSGLYDFGPVGCALKNNIIQTWRQHFQEEQILEIDCTMLTPEPVLKTSG-HVDKFADNLMFKTFIGPGGNMPGYLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREF-TMAEIEHFVDPSEKDHPKFQNVADLHLYLYSAYKKDAKLVMEYLAICDECYITEMEMLLNEKGEFTIETEGKTFQLTKDMINVKRFQKTLYVEEVVPNVIEPSFGLRIMYTVFEHTFHVREFSFPAVVAPFKCSVLPLS--QNQEFMPFVKELSEALTRHGVSHKVDDSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTTATLRDRDSMRQIRAEISELPSIVQDLANG--ADVEARYPLFEGQETGKKETI--EELE................................................. 687
26 -31.2003qne_A mol:protein length:485 Seryl-tRNA synthetase, cytoplasmic  ali model follow..  15  144AATGAPAKLSHHEVLLRLDGYDPERGVHRGYFLRNYGVFLNQALINYGLSFLSSKGYVPLQAPVMMNKEVMAKTA-QLSQFDEELYKVI----DGEDEKYLIATSEQPISAYHAGEWFSPAEQLPVRYAGYSSCFRREAKDAWGIFRVHAF-EKIEQFVL-TEPEKSWEEFDRMIGCSEEFYQSLGLPYRVVGIVSGELNNAAAKKYDLEAWFPFQQEYELVSCSNCTDYQSRNLEIRCGIKQQNQQHCLNSTLSATERTICCILENYQKEDGLVIPEVLRKY--------IPGEPEFIPYIKELPKNTTSVKKAKGKNPKNTTSVKKAKGKNGS............................................................................................................................ 478
27 -30.8005c51_B mol:protein length:485 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  11  59APGSGEGSEALLEICQRRHFLSDSLLSGCHPGFGPLGVELRKNLAAEWWTSVFREQVFPVDALHHKPGPLLPGDSAFRLVSAETLRQLVAFLENVLKTSGKLRENLLHGALEHYVNCLDLVNRLPYGLAQIGVCFHPVFDTKQIVKSIGEKTEAS---VWFTPPRTSNQWLDFWLRHRLQWWRKFAMSFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNPCVLSVNGDLDRGMLAYLYDSFQLTENLKLHPCLAPIKVALDVGRGPTLE--LRQVCQGLFNELLENWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKN........................................................................... 484
28 -30.0002g4c_A mol:protein length:474 DNA polymerase gamma subunit 2  ali model follow..  11  42APGSGEGSEALLEICQRRHFLSDSLLSGCHPGFGPLGVELRKNLAAEWWTSVFREQVFPVDALHHKPGPLLPGDSAFRLVSAETLRQLVTFLENVLKTSGKLRENLLHGALEHYVNCLDLVNRLPYGLAQIGVCFHPVFDTKQIVKSIGEKTEAS---VWFTPPRTSNQWLDFWLRHRLQWWRKFAMSFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNPCVLSVNGDLDRGMLAYLYDSFQLTENLKLHPCLAPIKVALDVGRGPTLE--LRQVCQGLFNELLENWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKN........................................................................... 467
29 -28.5004ztu_B mol:protein length:472 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  12  35APGSGEGSEALLEICQRRHFLSDSLLSGCHPGFGPLGVELRKNLAAEWWTSVFREQVFPVDALHHKPGPLLPGDSAFRLVSAETLR-LVAFLENVLKTSGKLRENLLHGALEHYVNCLDVNKRLPYGLAQIGVCFHPVFDTKQIVKSIGEKTEAS---VWFTPPRTSNQWLDFWLRHRLQWWRKFAMSFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNPCVLSVNGDLDRGMLAYLYDSFQLTENLKLHPCLAPIKVALDVGRGPTLE--LRQVCQGLFNELLENWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKN........................................................................... 460
30 -26.8004h2w_A mol:protein length:346 Amino acid--[acyl-carrier-protein] ligase 1  ali model follow..  13  22.NSPDTAPQIADPLDHLADKLFHSMGSDGVYARTALYESIVERLAALI-TSHREAGTEALRFPPVMSRAQLEKSG-YLKSFPNLLGCVCGLHGTEREADLVLSPAACYPVYPIAASRGPL-PKGGLRFDVAADCFRRE--PSKHLDRLQSFRMRE--YVCIGTPDDVSDFRERWMVRAQAIARDLGLTFRVDYASDPFFGRAGKMLANNQRDQQEEQPTACMSFNYHREHFGTTWGIQDANGE----PAHTGCVAFGMRLAVAMFHTHGTDLS-AWPAKVRDI................................................................................................................................................................................ 323
31 -25.9003mey_A mol:protein length:346 Bll0957 protein  ali model follow..  13  22.NSPDTAPQIADPLDHLADKLFHSMGSDGVYARTALYESIVERLAALI-TSHREAGTEALRFPPVMSRAQLEKSG-YLKSFPNLLGCVCGLHGTEREADLVLSPAACYPVYPIAASRGPL-PKGGLRFDVAADCFRRE--PSKHLDRLQSFRMRE--YVCIGTPDDVSDFRERWMVRAQAIARDLGLTFRVDYASDPFFGRVGQMKAVSQKLRSEEQPTACMSFNYHREHFGTTWGIQDANGE----PAHTGCVAFGMRLAVAMFHTHGTDLS-AWPAKVRDI................................................................................................................................................................................ 323
32 -25.2003ikl_A mol:protein length:459 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  11  59APGSGEGSEALLEICQRRHFLSDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKP-------------------GPLLPGDSAFRGGLRENLLHGALEHYVNCLDLVNRLPYGLAQIGVCFHPVFDTKQIVKSIGEKTEAS---VWFTPPRTSNQWLDFWLRHRLQWWRKFAMSFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNPCVLSVNGDLDRGMLAYLYDSFQLTENLKLHPCLAPIKVALDVGRGPTLE--LRQVCQGLFNELLENWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKN........................................................................... 452
33 -25.1001g5h_A mol:protein length:454 MITOCHONDRIAL DNA POLYMERASE ACCESSORY SUBUNIT  ali model follow..  13  17APEHAVAREALVDLCRRRHFLSTAALLSGCHAFGPLGVELRKNLASQWWSSMVVFREQVFAVDSLHQEP--ESIREILQDREPSKEQLVAFLENLLKTSGKLRATLLHGALEHYVNCLDLVNKLPFGLAQIGVCFHNSNQTPSSVTRVGEKTEAS---VWFTPTRTSSQWLDFWLRHRLLWWRKFAMSFSSADCQDELGRKGSKLYYSFPWGKEPIETLWNLGDQELLHTYPGNVSTIQGRDGRKNPCVLSVSGDVDLGTLAYLYDSFQLAENLKLHPCLAPIKVALDVGKGPTVE--LRQVCQGLLNELLENWPGYSETVHSSLEQLHSKYDEMSVLFSVLVTETTLENGLIQLRSRDTTMKEMMHISKLRDFLVKYLASASN........................................................................... 442
34 -23.4001qe0_A mol:protein length:420 Histidine--tRNA ligase  ali model follow..  16  3........................KIPRGTQDILPEDSKKWRYIENQLDELMTFYNYKEIRTPIFESTDLFARG---VGDSTDVVQKEMYTFKDKGDRSITLRPEGTAAVVRSYEHKMQGNPNQPIKLYYNGPMFRYE-RKQKGRYRQ---FNQFGVEAIGAENPSVDAE---VLAMVMHIYQSFGLKHLKLVINSEESKAYYEQVKAYLDDLGIPYTEDPNLVRGLDYYTHTAFELMMDNPNYDGAITTLCGGGRYNGLLELLDGPSETGIGFALLDIEENLDLFIVTMGDQADRYAV----KLLNHLRHNGIKADKDYLQRKIKGQMKQADRLGAKFTIVIGDQELENNKIDVKNMTTGESETIELDALVEYFKK.................................................................................. 420
35 -22.9003w3s_A mol:protein length:527 Type-2 serine--tRNA ligase  ali model follow..  19  186GPRRIRFRGDVTEEARRRGWV-KEFPGRGQWIYTPPMAALFEVLRDFLLERVRKLGFEPALFPKLIPLETMFRMR-YLHGLPDGMYYVCPPKRDPEDPGYVLAPAQCEPFYELLRDEVVDPERLPIKLYDCGWTYRWEGGAAKGLERVNEFQRIE--HVWIAEPEEAYRIRRELLEATKRVAEELELEWKVVVSDDRDIELPDVPSYEFEVYLPEEAWISVGSFNVHGEHFVDGFNV----KEKSGRTLFTGCAGLGVRWVVGLLAQHGFYPY-EWPEPI................................................................................................................................................................................... 505
36 -22.8001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  14  7........................EKIRGFRDFYPEDMDVEKFIFKTAEEAAEAFGFRRIDFPSLEYLDLYRIK------SGEELLQQTYSFVDKGGREVTLIPEATPSTVRMVTS--RKDLQRPLRWYSFPKVWRYE-EPQAG--RYREHYQF-NADIFGSDSPEADAE---VIALASSILDRLGLQIDEMARITGKSSEEIARMAAVEDLLASYGVKNVRYDFSIVRGLSYYTGIVFEAYDRSGQFRAILGGGRYDNLASLMISLLLKRENVQIPREKKSVYICRV------GKINSSIMNEYSRKLRERGMNVTVEIMERGLSAQLKYASAIGADFAVIFGERDLERGVVTIRNMYTGSQENVGLDSVVEHLISQATL.............................................................................. 427
37 -22.7004rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  13  6........................RAVRGTKDLFGKELRMHQRIVATARKVLEAAGALELVTPIFEETQVFEKG---VGAATDIVRKEMFTFQDRGGRSLTLRPEGTAAMVRAYLEHGMKVWPQPVRLWMAGPMFRAE-RPQKGRYRQ---FHQVNYEALGSENPILDAE---AVVLLYECLKELGLRRLKVKLSSEEARAHLKEVERHLERLSVPYELEPALVRGLDYYVRTAFEVHHEEIGAQSALGGGGRYDGLSELLGRVALALEAEG--FGLPEEKGPDLYLIPLTEEAVAEAF-----YLAEALRPRLRAEYALAPRKPAKGLEEALKRGAAFAGFLGEDELRAGEVTLKRLATGEQVRLSREEVPGYLLQALG............................................................................... 423
38 -22.0003vbb_A mol:protein length:522 Seryl-tRNA synthetase, cytoplasmic  ali model follow..  15  167.......KYSHVDLVVMVDGFEGEKGASRGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKVIGKGSEKSSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQEVRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFEEMITTAEEFYQSLGIPYHIVNIVSGSLNHAASKKLDLEAWFPGSGAFELVSCSNCTDYQARRLRIRYGQTKKMMDHMLNATMCATTRTICAILENYQTEKGITVPEKLKEFLQELIP---FVKPAPIEQEPSKKQKKQHEGSKKKAAARDVTLENRLQNMEVT............................................................................................................................ 512
39 -21.9001ser_A mol:protein length:421 PROTEIN (SERYL-TRNA SYNTHETASE (E.C.6.1.1.11))  ali model follow..  14  125GPPEFSFPPLDHVALMEKNGWWEPRISSRSYALKGDLALYELALLRFAMDFMARRGFLPMTLPSYAREKAFLGTGHFPAYRDQVWAI--------AETDLYLTGTAEVVLNALHSGEILPYEALPLRYAGYAPAFRSEAKDVRGLMRVHQFHKVEQYVLTEASLEASDRAFQELLENAEEILRLLELPYRLVEVATGDMGPGKWRQVDIEVYLPSEGRYETHSCSALLDWQARRANLRYRDPEGRVRYAYTNTALATPRILAMLLENHQLQDGVRVPQALIPY................................................................................................................................................................................ 411
40 -21.6003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  15  24........................EPVQGCRDFPPEAMRCRRHLFDVFHATAKTFGFEEYDAPVLESEELYIRK------AGEEITEQMFNFITKGGHRVALRPEMTPSLARLLLGKGRSLL-LPAKWYSIPQCWRYEAITR----RRREHYQW-NMDIVGVKSVSAEVE---LVCAACWAMRSLGLSSKDVGIKVNSRKEEHEAVKELRQFFEQVEAYGYGDWVLFDASVVRGLAYNLLTTYGSPTPIPCAGFGFGDCVIVELLQEKR-----LLPDIPHVVDDVVIPF----DESMRPHALAVLRRLRDAGRSADIILDKKKVVQAFNYADRVGAVRAVLVAPEEWERGEVQVKMLREGTGKEEGGAERGFAVPL.................................................................................. 446
41 -21.2003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  14  24........................EPVQGCRDFPPETMRLRKYLFDVFHSTARKFGFEEYDSPVLESEELYIRK------AGEEITEQMFNFITKGGHRVALRPEMTPSLARQLLAKGRSLL-LPAKWYSIPQCWRYEAITR----RRREHYQW-NMDIIGVKSVSSEVE---LVCAACTAMQSLGLSSKDVGVKINSR-EEHEAVRELRDFITQIEAYGFGDWVIFDASVVRGLAYNLLTTYGSPTAVPCVGFGFGDCVIVELLNEKK-----LLPELHHVVDDLVIPF----DETMRPHALSILRRLRDAGRSADIVFDKKKVVQAFNYADRIGALRAVLVAPDEWARGEVRVKMLREGAGREEGANERGIVLPV.................................................................................. 446
42 -20.9001wle_A mol:protein length:501 Seryl-tRNA synthetase  ali model follow..  16  179.......PRGHLEIAEKLDIIRQKRHVSGSYYLRGAGALLQHGLVNFTLNKLIHRGFTPMTVPDLLRGVVFEGCGMTPNAKPSQIYNI----DPSRFEDLNLAGTAEVGLAGYFMDHSVAFRDLPIRMVCSSTCYRAETKEPWGLYRVHHFTKVEMFGVTGPGLEQSSELLEEFLSLQMEILTELGLHFRVLDMPTQELGLPAYRKFDIEAWMPGRGR-EVTSASNCTDFQSRRLHIMFQTEAGELQFAHTATGCAVPRLLIALLESYQQKDGVLVPPALQPY................................................................................................................................................................................ 461
43 -20.7003lsq_A mol:protein length:484 Seryl-tRNA synthetase  ali model follow..  14  167NTTKRAKLNHVSIMERLGMMDTSKASMAGSYVLKGGLVQLQVALVSYSLDFLVKRGYTPFYPPFFLNRDVMGEVAQLSQFDEELYQV------SGDGDKKYLIATSEMPIAAYHRGRWFTELKEPLKYAGMSTCFRKEARDTLGIFRVHQFDKIEQFVVCSPRQEESWRHLEDMITTSEEFNKSLGLPYRVVNICSGALNNAAAKKYDLEAWFPASGA-ELVSCSNCTDYQSQSVNCRYGPNLRGTAHMLNGTLCAITRTMCCICENYQTEEGVVIPDVLRPY................................................................................................................................................................................ 460
44 -20.7002dq3_A mol:protein length:425 Seryl-tRNA synthetase  ali model follow..  18  131PRKFDFEPKPHWEIGERLGILDFKRGASRFTVIAGWGARLERALINFMLDLHTKKGYKEICPPHLVKPEILIGTGQLPKFEEDLYKC--------ERDNLYLIPTAEVPLTNLYREEILKEENLPIYLTAYTPCYRREAKDIRGIIRQHQFDKVE---VKIVHPDTSYDELEKLVKDAEEVLQLLGLPYRVVELCTGDLGFSAAKTYDIEVWFPSQNKYEISSCSNCEDFQARRMNTRFKDSKTGKNRFVHTLNGSGLRTLAAILENYQQEDGVVVPEVLRDY................................................................................................................................................................................ 416
45 -20.6003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  13  13........................STPSGFPEFLPSEKRLELYLLDTIRRVYESYGFTPIETPAVERLEVLQAKGNQGDNLPPNRQAEKDKSGDTGSEARALKFDQTVPLAAYIARHLNDLT-FPFARYQMDVVFRGE-RAKDGRFRQ---FRQCDIDVVGREKLSLLYDA-QMPAIITEIFEAVNIGDFVIRINNRKVLTGFFQSVRNLGVPDKRFCIDLAIARGLNYYTGTVYETTLIGHEALGSICSGGRYEELVGTFIG-LISRLLKAGILNTLPPTPAQVVVVNM----QDELMPTYLKVSQQLRQAGLNVITNFEKRQLGKQFQAADKQGIRFCVIIGADEAAAQKSSLKDLQSGEQVEVALADLAEEIKRRLT............................................................................... 465
46 -20.5003err_A mol:protein length:536 fusion protein of microtubule binding domain from mouse cytoplasmic dynein and seryl-tRNA synthetase from Thermus thermophilus  ali model follow..  16  243........LDHVALMEKNGWWEPRSQVSGSYALKGDLALYELALLRFAMDFMARRGFLPMTLPSYAREKAFLGTG-HFPAYRDQVWAI-------AETDLYLTGTAEVVLNALHSGEILPYEALPLRYAGYAPAFRSEAKDVRGLMRVHQFHKVEQYVLTEASLEASDRAFQELLENAEEILRLLELPYRLVEVATGDMGPGKWRQVDIEVYLPSEGRYETHSCSALLDWQARRANLRYRDPEGRVRYAYTNTALATPRILAMLLENHQLQDGVRVPQALIPY................................................................................................................................................................................ 520
47 -20.4006blj_A mol:protein length:485 Serine-tRNA ligase  ali model follow..  16  175DPETGYKCLKHIDIMRKLGGLATEEQVGGGYFLLGDLVRMNLALQNYAIDFLAKKGYMPIYTPFFMTKEQMKKVAQLSQFDEELYTV------TGEGEDKYLIATSEQPIAAFHLEKRFDESELPIKYCGMSTCFRKEVKDTLGIFRVHQFEKIEQFVVTSPKDNKSWEMFDEMIGNSEAFYQSLGIPYRVVNIVSGALNNAAAKKFDLEAWFPGADE-ELVSCSNCTDYQTRRLEVKYGKSKKQGSHMLNSTLTATSRTLCCIVENYQTPEGVNVPEVLQPY................................................................................................................................................................................ 468
48 -20.4002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  12  4...............YQDPMAKNIQAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRA---IGEVTDVVEKEMYTFEDRNGDSLTLRPEGTAGCVRAGIEH-GLLYNQEQRLWYIGPMFRHE-RPQKGRYRQ---FHQLGCEVFGLQGPDIDAE---LIMLTARWWRALGISSLEARANYRDALVAFLEQHKEKLDEDCKRRMYTNPLRVLDSKNPEVFEWVTNSLGSQGTVCAGGRYDGLVEQLGRLVLLVQAVN--PEFKADPVVDIYLVASGADTQSAAMALAERLRDE--LPGVKLMTNHGGGNFKKQFARADKWGARVAVVLGESEVANGTAVVKDLRSGEQTAVAQDSVAAHLRTLLG............................................................................... 431
49 -20.3005c53_B mol:protein length:903 Pol gamma B  ali model follow..  10  59APGSGEGSEALLEICQRRHFLSDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPV--------------------DALHHKPGPLLPGDSAFRKLRENLLHGALEHYVNCLDLVNRLPYGLAQIGVCFHPVFDTKQIVKSIGEKTEAS---VWFTPPRTSNQWLDFWLRHRLQWWRKFAMSFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKN-CVLSVNGDLDRGMLAYLYDSFQLTENLKLHPCLAPIKVALDVGRGPTLE--LRQVCQGLFNELLENWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNVMRSRVAVRACHKVCRCLLSGFGGRVDAGQP............................................ 482
50 -20.2005e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  12  7........................VAIKGFNDVLPTQTAAWRRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRAGDATDIVEKEMY--TFFDKGNPPESLTLRPEGTAGCVRALVEH-NLLRGATPRVWYMGPMFRYE-KPQKGRYRQ---FHQFGVETFGVATPDIDAE---LIMLTARLWKRMGVDHMVQLELNTDSLSHFQQLQDYLTAAGIKFVINQKLVRGLDYYNKTVFEWTTTALGSQGTVCAGGRYDGLVGQLKGKADQSVPAVGFAMGME-VRDCEAFLVAEPAYQSKAL----VLAEQLRDQLEAANSN-SQGSMKSQMKKADQAGAVYAIILGEREWEAQQLAVKELATAEQSQVALAELVPFLIEKFTK.............................................................................. 432
51 -20.0002dq0_A mol:protein length:455 Seryl-tRNA synthetase  ali model follow..  18  160........KLHVDLLEILGGADFARAASRFYYLLNEIVILDLALIRFALDRLIEKGFTPVIPPYMVRRFVEEGSTSFEDFEDVIYKV--------EDEDLYLIPTAEHPLAGMHANEILDGKDLPLLYVGVSPCFRKEAKDTKGIFRVHQFHKVE---FVYSRPEESWEWHEKIIRNAEELFQELEIPYRVVNICTGDLGYVAAKKYDIEAWMPGQGKFEVVSASNCTDWQARRLNIRFRDRTDEKPRYVHTLNSTAIRAIVAILENHQEEDGVRIPKVLWKY................................................................................................................................................................................ 437
52 -18.9004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  15  68........................KTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGK-------YGEDSKLIYDLKDQGGELLSLRY-----LTVPFARYLAMNKLTNIKRYHIAKVYRRD-NPAMTRGRYREFYQC-DFDIAGNFDPMIPD--AECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAEYLTLFGIDDKISFDLSLARGLDYYTGVIYEAVLLQTPAQAKGRKVPCVGLSIGVERIFSIVEQRLEALEEKIRTTETQVLVASA----QKKLLEERLKLVSELWDAGIKAELLKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQ.............................................................................. 515
53 -18.8004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  13  4.GTLEAQTQGPGSMTEQKRKLEKLTGVKGMNDILPQDAGLWEFFEATVKSLLRAYGYQNIRTPIVEHTPLFTRGGEVTDIVEKEMYSFV---DALNGENLTLRPENTAAVVRAAIEH-NMLYDGPKRLWYIGPMFRHE-RPQRGRYRQ---FHQVGVEALGFAGPDADAE---IVMMCQRLWEDLGLTGIKLEINSDVSRAHFEGLQRLLKANNVPFTINPRLVRGLDYYNLTVFEWVTDKLGAQGTVAAGGRYDPLIEQLGG-ILELLKEEHLV--PEQEGVDVYVVHQGDAAREQAFIVAERLRDTGLDVILHCSADGAGASFKSQMKRADASGAAFAVIFGEDEVTNGTASVKPGEKSVQQSVPVESLTEFLINAMVATAED.......................................................................... 458
54 -18.7004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  15  15........................KTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGK-------YGEDSKLIYDLKDQGGELLSLRY-----LTVPFARYLAMNKLTNIKRYHIAKVYRRD-NPAMTRGRYREFYQC-DFDIAGNFDPMIPD--AECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAEYLTLFGIDDKISFDLSLARGLDYYTGVIYEAVLLQTPAQAKGRKVPCVGLSIGVERIFSIVEQRLEALEEKIRTTETQVLVASA----QKKLLEERLKLVSELWDAGIKAELLKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQ.............................................................................. 462
55 -18.5004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  17  16LNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDT-------ELSKQIFRVDKNFCLRPMLAPNLANYLRKLDRALPD-PIKIFEIGPCYRKESDGKEHL---------EEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDS........................................................................................................................................................................................................................................................................ 194
56 -18.1001v95_A mol:protein length:130 Nuclear receptor coactivator 5  ali model follow..  12  8.........................................................................................................................................................................................................................................................................................PVDCSVIVVNKQTKD-----YAESVGRKVRDGMVVDLINTEVSLSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTEHRNMPQADAMVLVARNYERYKNECREKERE................................................................... 118
57 -17.4005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  18  17.NPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMG--------DNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPD-PIKIFEIGPCYRKESDGKEHL---------EEFTMLAFAQMGSGCTRENLESIITDFLNHLGIDFKIVGDS........................................................................................................................................................................................................................................................................ 194
58 -17.1004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  17  33LNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMG-------IDNDTELSKQIFRVDKNFCLRPMLAPNLGNYLRKLDRALPD-PIKIFEIGPCYRKESDGKEHL---------EEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDS........................................................................................................................................................................................................................................................................ 211
59 -16.7004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  18  16.NPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDT-------ELSKQIFRVDKNFCLRPMVAPNIFNYARKLDRALPD-PIKIFEIGPCYRKESDGKEHL---------EEFTMLNFFQMGSGCTRENLESIITDFLNHLGIDFKIVGDS........................................................................................................................................................................................................................................................................ 193
60 -16.7003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  18  30LNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDT-------ELSKQIFRVDKNFCLRPMLTPNLYNYLRKLDRALPD-PIKIFEIGPCYRKESDGKEHL---------EEFTMLVFWQMGSGCTRENLESIITDFLNHLGIDFKIVGDS........................................................................................................................................................................................................................................................................ 208
61 -16.2002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  16  50FSDALSRDRAFQGIEHQLMSQGKRHL----QLRTVKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEDH--------LFSQVFWLDGKKCLRPMLAPNLYTLWRELERLWDK-PIRIFEIGTCYRKESQGAQ---HLNEFTMLN----LTELGTPLEERHQRLEDMARWVLEAAGIREFELVTESSVVYG.................................................................................................................................................................................................................................................................. 232
62 -15.9002lw7_A mol:protein length:170 Histidine--tRNA ligase, cytoplasmic  ali model follow..  16  68........................................................................................................................................................................................................................................................................................TETQVLVASAQ----KKLLEERLKLVSELQDAGIKAELLKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQ.............................................................................. 165
63 -15.8002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  20  65...............................IYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMG-------IDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPD-PIKIFEIGPCYRKESDGKEHL---------EEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDS........................................................................................................................................................................................................................................................................ 211
64 -15.3003od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  10  11........................EKPFGMRDTLPEWYKTKKNICDQMTEEINLWGYDMIETPTLEYYETVGVVS-------AILDQQLFKLLDQQGNTLVLRPDMTAPIARLVASSLKD-RAYPLRLAYQSNVYRAQQNEG-----KPAEFEQLGVELIGDGTASADGE---VIALMIAALKRAGLSEFKVAIGHVGYVNALLMDVEMTKLYEVLESYGASEYVKFDLTLVLHMSVVFE--SGGRYDELLSKFHRPAQATGFGVRIDLLVEALNGEIISNGHEQTCILFSNERRFEAI----ELARKKRANGEAVVLQDLAGVTDVDAMSSNYQDVIYCIGTAGRGGEDA............................................................................................................ 400
65 -14.4004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  20  65...............................IYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDT--------LSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPD-PIKIFEIGPCYRKESDGKEHL---------EEFTMLSFIQMGSGCTRENLESIITDFLNHLGIDFKIVGDS........................................................................................................................................................................................................................................................................ 211
66 -12.4003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  12  24........................DRPPGMQDGYPDFAKRRRAVETRLLSFVEDAGYEPVTSGLFEYVDTLLRA------RSPESSRDWIRLFDGGGDAVALRPEMTPSIARMAAPRVAA-GRTPIRWCYCERVYRRTDDPASLSWASGKAAESTQVGIERIGEEASVDVDMDVLRLLHEASAAAGVRHHRIVVSHARLVPRLLDAL---GISASLSRAFLACLTSGNYVQFRELWQLHAAKDVDLLANLLTWSPAERDAAKRSREASDRELEAL----LRDAVDPRAAADVRDAWRYLCRLAEALHDSGLASDVVTFDLADYYTGLVF-EMFAPGVGAPIAQGGR-------ELLAQFGAGAPAVGFAFEVERVMAVLEA.............................................................................. 365
67 -10.4001z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  11  20...........................EESAEMTLNQVKSLRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTAL---ESNGKTFNQEKMFQFIKHEGQSITLRY---DFTLPLVRLYSQIKDSTSARYSYFGKIFRKEKRHK-----RSTENYQIGIELFGESADKSELE---ILSLALQVIEQLGLNKTVFEIGS....................................................................................................................................................................................................................................................................... 175
68 -9.8206FTT Entity 1(prereleased)  ali follow..  5...........................DGVADVLFEDAHKQEVLRHQLTQQLITHGYQLVSPPMIEFTESLLSG------ASEDLKRQTFKIIDQLTRLMGIRA---DITPQILRIDAHHGGDGIARYCYAGDVIHTLPSGL-----GSRTPLQLGAEIFGCESIAADIE---LIDVLFSMINSLDMS----------------------------------AVLHVDLGHVTIFKRLAELSASDTEQLMQLYANKNLPELKQVCQVLPMGSDFYTLARFGHDIANLLGAQQDTKIVTAIDELQRLKAHLQVQCAVSIDVTHYHTGIVF-NGYINSETQPLVRGGRGMKSNQLATNQPRQATGFSMDVSRLLAHTQLD-SAQRQLLLQQVASLRQQGYRVTMPLTAEDMPVGLTHR........................................... 375
69 -9.8205m8h_A mol:protein length:388 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  5...........................DGVADVLFEDAHKQEVLRHQLTQQLITHGYQLVSPPMIEFTESLLSG------ASEDLKRQTFKIIDQLTRLMGIRA---DITPQILRIDAHHGGDGIARYCYAGDVIHTLPSGL-----GSRTPLQLGAEIFGCESIAADIE---LIDVLFSMINSLDMS----------------------------------AVLHVDLGHVTIFKRLAELSASDTEQLMQLYANKNLPELKQVCQVLPMGSDFYTLARFGHDIANLLGAQQDTKIVTAIDELQRLKAHLQVQCAVSIDVTHYHTGIVF-NGYINSETQPLVRGGRGMKSNQLATNQPRQATGFSMDVSRLLAHTQLD-SAQRQLLLQQVASLRQQGYRVTMPLTAEDMPVGLTHR........................................... 375
70 -9.5803g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  11  17.....................................LLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIH-------LFPFETRFVGPGHSQGINLYLMTSPEYHMKRLLAAGCG-------PVFQLCRSFRNEEMGRHH---NPEFTML-EWYRPHYDMYRLMNEVDDLLQQVLDCQPAESLSYQQAQRHLEIDPLSADKTQLREAAAKLDLSNIADTEEDRDTLLQLLFTMGVEPHIGKEKPTFIYHFPASQASLAQI------------HRVAERFEVYYKGIELANGFHELTDAREQQQREQDNRKRAARGLPQQPIDQNLLDALAAGLPVMLALGAESLAD............................................................................................................. 317
71 -9.1503a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  11  30.....................................LLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIH-------LVPFETRFVGPGHSQGMNLWLMTSPEYHMKRLLVAGCG-------PVFQLCRSFRNEEMGRYH---NPEFTML-EWYRPHYDMYRLMNEVDDLLQQVLDCPAAESLSYQQALRYLEIDPLSADKTQLREVAAKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGKEKPTFVYHFPASQASLAQI------------HRVAERFEVYYKGIELANGFHELTDAREQQQREQDNRKRAARGLPQHPIDQNLIEALKVGMPVMLALGAETLAE............................................................................................................. 330

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 6 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Awobuluyi M, Yang J, Ye Y, Chatterton JE, Godzik A, Lipton SA, Zhang D. Subunit-specific roles of glycine-binding domains in activation of NR1/NR3N-methyl-D-aspartate receptors. Mol Pharmacol. 2007 Jan;71(1):112-22. Epub 2006 Oct 17.