current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 1nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290
# Score Template Links and tools%idFirst MNAVEIISREISPTLDIQTKILEYMTDFFVKEGFKWLLPVIISPITDPLWPDPAGEGMEPAEVEIYGVKMRLTHSMILHKQLAIAMGLKKIFVLSPNIRLESRQKDDGRHAYEFTQLDFEVERAKMEDIMRLIERLVYGLFRKAEEWTGREFPKTKRFEVFEYSEVLEEFGSDEKASQEMEEPFWIINIPREFYDREVDGFWRNYDLILPYGYGEVASGGEREWEYEKIVAKIRKAGLNEDSFRPYLEIAKAGKLKPSAGAGIGVERLVRFIVGAKHIAEVQPFPRIPGIPAVILast
1 -130.0001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model  100  1MNAVEIISREISPTLDIQTKILEYMTDFFVKEGFKWLLPVIISPITDPLWPDPAGEGMEPAEVEIYGVKMRLTHSMILHKQLAIAMGLKKIFVLSPNIRLESRQKDDGRHAYEFTQLDFEVERAKMEDIMRLIERLVYGLFRKAEEWTGREFPKTKRFEVFEYSEVLEEFGSDEKASQEMEEPFWIINIPREFYDREVDGFWRNYDLILPYGYGEVASGGEREWEYEKIVAKIRKAGLNEDSFRPYLEIAKAGKLKPSAGAGIGVERLVRFIVGAKHIAEVQPFPRIPGIPAVI 294
2 -124.0003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein  ali model follow..  83  1MNAVEIISRDIYKAIDIQTKILDYMTKFFTDRGFKWLLPIMLSPITDPLWPDPAGEGIRPAEVDVYGVRMRLTHSMILHKQLAIAMGLEKIFVLSPNIRLESRRKDDGRHSYEFTQLDFEIEGAKMKDVMRLIEELIYGLFRKAEEWTGREFPRARHFKVYDYKDILEEFGSDEKASMEMEEPFWIVNIPREFYDREENGVWKNYDLILPYGYGEVSSGGEREWEYEKIVAKIRAAGLKEDSFRPYLEIARAGKLKPSAGAGIGVERLVRFIVGAKHIAEVQPFPRVPGIPAVI 294
3 -92.6003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  24  143.RHIVIRSEHTQQVLQLRSEIQWYFRKYYHDNHFTEIQPPTIVKT-------QCEGGSTLFKLQYFNEPAYLTQSSQLYLESVI-ASLGKSFCMLSSYRAE--QSRTVRHLAEYLHLEAELPFISFEDLLNHLEDLVCTVIDNVMAVHGDKIRKMNPFKRMTYADAIKYCNDERQMTDEIGCPIFMIHFPSKMKAFYMSKVPGHPDLLLMPGVGEIVGGSMRIWNYDELMGAYKANGLNPDPYYWYTQQRKYG-SCPHGGYGLGVERLVMWLLGEDHIRKVCLYPRYLERCE.. 455
4 -91.9001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  24  122.RHLHIRTPKASAIMKVKETLIMAAREWLLKDGWHEVFPPILVT-------GAVEGGATLFKLKYFDKYAYLSQSAQLYLEAAI-FGLEKVWSLTPSFRAE--KSRTRRHLTEFWHLELEAAWMDLWDIMKVEEELVSYMVQRTLELRKKEIEMFRPFPRISYDEAIDILQSERVLTEEFDRPFFVYGYPKHIKAFYMKEDPNDSDMLAPEGYGEIIGGSQREDDYDKLLNRILEEGMDPKDYEWYLDLRRYG-SVPHSGFGLGVERLVAWVLKLDHIRWAALFPRTPARLY.. 433
5 -91.1001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  24  124.RFMDLRRPEVMAIFKIRSSVFKAVRDFFHENGFIEIHTPKIIAT-------ATEGGTELFPMKYFEEDAFLAESPQLYKEIMMASGLDRVYEIAPIFRAE--EHNTTRHLNEAWSIDSEMAFIDEEEVMSFLERLVAHAINYVREHNAKELDILNPFPRVSYDKALEILGDKYMMENENAPLYFLYQYPSEAKPFYIMKYDNKRAFDLEYRGVEISSGGQREHRHDILVEQIKEKGLNPESFEFYLKAFRYG-MPPHGGFGLGAERLIKQMLDLPNIREVILFPRDRRRLT.. 437
6 -90.8001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  19  168.RVIDLRTVTNQAIFRIQAGVCELFREYLATKKFTEVHTPKLLGA-------PSEGGSSVFEVTYFKGKAYLAQSPQFNKQQLIVADFERVYEIGPVFRAEN--SNTHRHMTEFTGLDMEMAFEEYHEVLDTLSELFVFIFSELPKRFAHEIELVRKMVRLTYKEGIEMLRAKLVRDKYDTDFYILDKFPLEIRPFYTMPDPANNSYDFFMRGEEILSGAQRIHDHALLQERMKAHGLSPEDLKDYCDGFSYG-CPPHAGGGIGLERVVMFYLDLKNIRRASLFPRDPKRLR.. 489
7 -90.2004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  19  197.RVIDLRTSTSQAVFRLQSGICHLFRETLINKGFVEIQTPKIISA-------ASEGGANVFTVSYFKNNAYLAQSPQLYKQMCICADFEKVFSIGPVFRAED--SNTHRHLTEFVGLDIEMAFNYYHEVMEEIADTMVQIFKGLQERFQTEIQTVEPTLRLEYCEALAMLREHLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNNSYDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFG-APPHAGGGIGLERVTMLFLGLHNVRQTSMFPRDPKRLT.. 514
8 -90.2005xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  20  151.RHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQT-------QVEGGATLFKLDYFGEEAFLTQSSQLYLETCL-PALGDVFCIAQSYRAE--QSRTRRHLAEYTHVEAECPFLTFDDLLNRLEDLVCDVVDRILKSPAGSIVHERPFKRMNYSDAIVWLKEERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLVLMPNVGEIVGGSMRIFDSEEILAGYKREGIDPTPYYWYTDQRKYG-TCPHGGYGLGLERFLTWILNRYHIRDVCLYPRFVQRCT.. 465
9 -89.6001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  24  121.RVLDLRRQEMQAVIKIQSLALKAFRETLYKEGFIEIFTPKIIAS-------ATEGGAQLFPVIYFGKEAFLAQSPQLYKEL-MAGVVERVFEVAPAWRAEE--SDTPFHLAEFISMDVEMAFADYNDVMQLLEKILHNIVKTIKEEGKEELKILNPIKRLKYTEAIEILRSRILNEELKEDLYFIVDWPSDARPFYTKSKSENESFDLIYKFLEIVSGSTRNHKREVLEEALKKKGLKPESFEFFLKWFDYG-MPPHAGFGMGLARLMVMLTGIQSVKEIVPFPRDKKRLT.. 428
10 -88.9002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  19  121.RHLVIRGENAAALLRLRAAATRAMREHFYNAGYVEVAPPTLVQT-------QVEGGSTLFNLDYFGEQSFLTQSSQLYLETCIP-TLGDVFCIAQSYRAE--KSRTRRHLAEYAHVEAECPFITLDDLMEKIEELVCDTVDRLLADEEAKKLPERPFLRMEYKDAIKWLQEERFMTDTINKPILLNRFPSEIKAFYMQRDAKDNTLLLMPGVGEIVGGSMRIWKFDELSKAFKNVEIDPKPYYWYLDQRLYG-TCPHGGYGLGLERFICWLTNTNHIRDVCLYPRFVGRCV.. 436
11 -88.6001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  20  112.RYVTLRGEKARAPLKVQAALVRGFRRYLDRQDFTEIFTPKVVR-------AGAEGGSGLFGVDYFEKRAYLAQSPQLYKQIMV-GVFERVYEVAPVWRME--EHHTSRHLNEYLSLDVEMGFIDEEDLMRLEEALLAEMLEEALNTAGDEIRLLGDIPRLTHAEAKRILKEEYAKERWGSDWLFVTRYPRSVRPFYTYPEGTTRSFDLLFRGLEITSGGQRIHRYEELLESLKAKGMDPEAFHGYLEVFKYG-MPPHGGFAIGAERLTQKLLGLPNVRYARAFPRDRHRLT.. 421
12 -87.7003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  20  231.RMLDLRTVTNIAIFRIQSACCGLFREFLTSQKFVEIHTPKLIGC-------SSEGGSNIFEVKYFDRKAYLAQSPQLYKQMAIMGDFRKVFEVGPVFRAEN--SNTRRHLTEFEGLDIEMEIVNYHECIDVMEKLFTFIFDEIPKRFPDELKVIRPFLRLTYKEAIEMLRAELIKAKYNTDFYILDKFPAAIRPFYTMPDIDDNSYDVFVRGQEITSGAQRIHDPEFLMKRCIEKGVDPATLKDYIESFRFG-SWPHAGCGIGLERITMLYLGIPNIRKVTLFPRDPIRLN.. 547
13 -69.80011as_A mol:protein length:330 ASPARAGINE SYNTHETASE  ali model follow..  11  6.......IAKQRQISFVKSHFSRQLEERL---GLIEVQAPILSRVGDGTQDNGAEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQAGEGLYTHMKALRPDE-DRLSPLHSVYVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATEAAVSEEFDQIHFVHSQELLSRYPDLDAKGRERAGAVFLVGIGGKLSDGHGLNGDILVWNPVLEDAFELSSMGIRVDADTLKHQLALTGDEDRLELEWHQALLRGE-MPQTIGGGIGQSRLTMLLLQLPHIGQVGVWPAAVRESV.. 326
14 -66.7004lns_A mol:protein length:351 Asparagine synthetase a  ali model follow..  13  5.GYSSYV-LLQEQILTVKRSFSEALEKEL---NLVEVRAPILFRVGDGTQDNGFEKAVQVPVKAIPNASFEVVHSLAKWKRRTLAAPGHGLYTHMTALRVD--DVLDNIHSVVVDQWDWEMVMKDDQRNLAFLKEVVCKVYAAIRKTELAVCHLLLAYPNLTAKEREREIAREYGADWTSPVEASQVVFPRTSKPIPTMNSLSSLKNPTLDDSLEVSSMGIRVNAEALRHQISLTGDDSLLKSEWHQQLLNGE-FPQTVGGGIGQSRMVMFMLRKKHIGEVSVWPEEIRKKHNL 350
15 -61.2001efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model follow..  24  131.RYLDLRRRRMQENLRLRHRVIKAIWDFLDREGFVQVETPFLTKST----PEGARDFLVPYRHE--GLFYALPQSPQLFKQMLMVAGLDRYFQIARCFRDEDLRAD---RQPDFTQLDLEMSFVEVEDVLELNERLMAHVFREALGV-----ELPLPFPRLSYEEAMERYGSDKPDLRTYMHHPFTSPHPEDLPLLEKDPGRVALAYDLVLNGVEVGGGSIRIHDPRLQARVFRLLGIGEEEFGFFLEALEYG-APPHGGIAWGLDRLLALMTGSPSIREVIAFPKNKEGKDPL 558
16 -59.1004rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  18  124.RYLDLRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTLTRST----PEGARDFLVPARLQ--GSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRAD---RQPEFTQLDMEMSFVEADDVIAISEQVLKAVWATIGY------DLPLPLPRISYEEAMRRFGSDKPDLRTAMHHAFTAPKPDSVDTFDSDPNALSDAYDIVCNGNEIGGGSIRIHRRDIQERVFAMMGIDHDEFGFLLDAFSYG-APPHGGIAFGWDRITALLAGVDSIREVIAFPKSGGGVDPL 564
17 -58.8005w25_A mol:protein length:616 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  19  143.RYLDLRRDDPAAAIRLRSRVNAAARAVLARHDFVEIETPTITRST----PEGARDFLVPARLH--GSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRAD---RQPEFTQLDMEMSFVDAEDIIAISEEVLTELWALIGY------RIPTPIPRIGYAEAMRRFGTDKPIDPDAWAFVWVVDPPLFEPADSDTGSVLADAYDIVCNGHEIGGGSVRIHRRDIQERVFAVMGLDKAEFGFLLEAFMFG-APPHGGIAFGWDRTTALLAGMDSIREVIAFPKTGGGVDPL 583
18 -58.4004wj3_M mol:protein length:599 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  22  130.RFIDLRRPEMAAKLKLRARITSSIRRYLDDNGFLDVETPILGRPT----PEGARDYLVPSRTY--GHFFALPQSPQLFKQLLMVAGFDRYYQIAKCFRDEDLRAD---RQPEFTQIDIETSFLDESDIIGITEKMVRQLFKEVLD------VEFDEFPHMPFEEAMRRYGSDKPLLTREWAPMWVVDFPTPAELEANPGAALSRAYDMVLNGTELGGGSIRIHDKSMQQAVFRVLGIDEAEFGFLLDALKYG-APPHGGLAFGLDRLVMLMTGASSIREVIAFPKTQSAGDVM 567
19 -58.1004o2d_A mol:protein length:620 Aspartate--tRNA ligase  ali model follow..  18  140.RYLDLRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTLTRST----PEGARDFLVPARLQ--GSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRAD---RQPEFTQLDMEMSFVEADDVIAISEQVLKAVWATIGY------DLPLPLPRISYEEAMRRFGSDKPDLRTAMHHAFTAPKPDSVDTFDSDPNALSDAYDIVCNGNEIGGGSIRIHRRDIQERVFAMMGIDHDEFGFLLDAFSYG-APPHGGIAFGWDRITALLAGVDSIREVIAFPKSGGGVDPL 580
20 -55.4004ah6_A mol:protein length:617 ASPARTATE--TRNA LIGASE, MITOCHONDRIAL  ali model follow..  20  135.RYLDLRSFQMQYNLRLRSQMVMKMREYLCNLGFVDIETPTLFKRT----PGGAKE---LVPSREPGKFYSLPQSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPD---RQPEFTQIDIEMSFVDQTGIQSLIEGLLQYSWPNDKD------PVVVPFPTMTFAEVLATYGTDKPDDPTLFSFLWVVDFPLFLPKEENPRKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILATLLKEDVKLSHLLQALDYG-APPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFRGHDLM 575
21 -55.3001eqr_A mol:protein length:590 ASPARTYL-TRNA SYNTHETASE  ali model follow..  21  125.RYLDLRRPEMAQRLKTRAKITSLVRRFMDDHGFLDIETPMLTKAT----PEGARDYLVPSRVH--GKFYALPQSPQLFKQLLMMSGFDRYYQIVKCFRDEDLRAD---RQPEFTQIDVETSFMTAPQVREVMEALVRHLWLEVKG------VDLGDFPVMTFAEAERRYGSDKPGEGGLTAMHHPFTSPKDMTAAELKAAPVANAYDMVINGYEVGGGSVRIHNGDMQQTVFGILGINEEEFGFLLDALKYG-TPPHAGLAFGLDRLTMLLTGTDNIRDVIAFPKTTAAACLM 564
22 -50.1003g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  18  9......QPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPFETRFVGPGHSQGINLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEM---GRHHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCQPAESLSYQQAFQRHLEIDPLSA-LLFTMGVEPHIGKEKPTFIYHFPASQASLSTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAA-QNLLDALAAG-LPDCSGVALGVDRLVMLALGAESLADVIAFT......... 322
23 -49.2003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  17  13.SHMSEQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGPGHSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEM---GRYHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPLSADKLFTFGVEPNIGKEKPTFVYHFPASQASLSTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAA-QNLIEALKVG-MPDCSGVALGVDRLVMLALGAETLAEVIAFS......... 335
24 -47.3003bju_A mol:protein length:521 Lysyl-tRNA synthetase  ali model follow..  18  162.RYLDL-NDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNII-----PGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGI---DLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHIPEGQAYDVDFTPPFRRINMVEELEKALGGEFLEVTCINPTFICDHPQIMSPLHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAA-ENFCTALEYG-LPPTAGWGMGIDRVAMFLTDSNNIKEVLLFP......... 503
25 -46.8005hgq_A mol:protein length:524 Lysine--tRNA ligase  ali model follow..  15  164.RYLDL-NPDVKNRFVTRSRMISFLRRYLDNLGFLEVETPMMNLI-----AGGATAKPFITHHNDLDMDLYLRVAPELYLKMLVVGGIDRVYEIGRVFRNEGI---DQTHNPEFTSCEFYMAYADYEDLMKITEDMLARMVYYMHGTYVYEVDFTPPFRKVNIYDGLQEKLGGEFLEPTFISPTFLTGHPQIMSPLHRSIPGLTERFELFVVTKEIVNAYTELNDPLTQRLRFDEQAKQKQA-ENYCTALEYG-LPPTAGWGMGIDRLAMILTDSNNIKEVLFFP......... 506
26 -46.5005eln_A mol:protein length:535 Lysine--tRNA ligase  ali model follow..  20  172.RYLDL-NEESRKVFKLRSRAIKYIRNYFDRLGFLEVETPMLNMI-----YGGAAARPFITYHNELETQLYMRIAPELYLKQLIVGGLDKVYEIGKNFRNEGI---DLTHNPEFTAMEFYMAYADYYDLMDLTEELISGLVLEIPEGKCIEIDFTTPWKRFSFVEEIESGLGGHFVETKCTNPSFIIDHPQTMSPLHREKPEMTERFELFVLGKELCNAYTELNEPLQQRKFFEQQADAKAS-ETFCLALEHG-LPPTGGWGLGIDRLIMFLADKNNIKEVILFP......... 511
27 -46.4004ycv_A mol:protein length:516 Lysine--tRNA ligase  ali model follow..  18  162.RYLDL-NESSRHTFVTRTKIINFLRNFLNERGFFEVETPMMNLI-----AGGANARPFITHHNDLDLDLYLRIATELPLKMLIVGGIDKVYEIGKVFRNEGI---DNTHNPEFTSCEFYWAYADYNDLIKWSEDFFSQLVYHLFENQPIEIDFTPPYPKVSIVEEIEKLASHFIENKYNDKPFFIVEHPQIMSPLHRTKPGLTERLEMFICGKEVLNAYTELNDPFKQKECFKLQQKDREK-SAFCTSLEYG-LPPTGGLGLGIDRITMFLTNKNSIKDVILFP......... 502
28 -46.3001e1o_A mol:protein length:504 LYSYL-TRNA SYNTHETASE, HEAT INDUCIBLE  ali model follow..  21  169.RYLDL-NDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVI-----PGGASARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGI---SVRHNPEFTMMELYMAYADYHDLIELTESLFRTLAQEVVTYGEHVFDFGKPFEKLTMREAIKKYRPDEVAEAHLIQPTFITEYPAEVSPLNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAERFQEQVNAKAA-EDYVTALEYG-LPPTAGLGIGIDRMIMLFTNSHTIRDVILFP......... 498
29 -46.2006aqh_A mol:protein length:508 Lysine--tRNA ligase  ali model follow..  15  167.RYVDL-RDQARKVARQRIAVMRAIRSALERRGFLEVETPMLQTL-----AGGAAARPFVTHSNALDTELYLRIAPELFLKRCLVGGFERVFELNRVFRNEGA---DSTHSPEFVMLETYQAYGTYDDSAVVTRELIQEVADEAIGTRGTVYDLDGEWESIQMYPSLSEALGEHTVGAKLWAPTFVKDFPVETTPLHRSIPGVTEKWDLYVRRIELATGYSELTDPIIQRERFEAQARAAAA-EDFLAALEYG-MPPSTGTGMGIDRLMMTLTG-LSIRETVLFP......... 497
30 -45.9003a74_A mol:protein length:493 Lysyl-tRNA synthetase  ali model follow..  19  160.RYLDL-NPESKKTFITRSLIIQSMRRYLDSHGYLEVETPMMHAV-----AGGAAARPFITHHNALDMTLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGI---STRHNPEFTMLELYEAYADFRDIMKLTENLIAHIATEVIQYGEHLVDLTPEWRRLHMVDAIKEYVGEQKVEDKLIQPTFIYGHPVEISPLNPDDPRFTDRFELFIVGREHANAFTELNDPIDQRQRFEEQLKEREQ-EDFLEALEYG-MPPTGGLGIGVDRLVMLLTNSPSIRDVLLFP......... 488
31 -45.9001bbu_A mol:protein length:504 PROTEIN (LYSYL-TRNA SYNTHETASE)  ali model follow..  21  169.RYLDL-NDESRNTFKVRSQILSGIRQFMVNRGFMEVETPMMQVI-----PGGAAARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGI---SVRHNPEFTMMELYMAYADYKDLIELTESLFRTLAQDIVTYGDVTLDFGKPFEKLTMREAIKKYRPEEVAEAHLIQPTFITEYPAEVSPLNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAQRFLDQVAAKDA-EDYVTALEHG-LPPTAGLGIGIDRMVMLFTNSHTIRDVILFP......... 498
32 -45.9005vl1_A mol:protein length:506 Lysine--tRNA ligase  ali model follow..  15  164.RYVDL-RPQAREVARQRIAVIRAVRNALERRGFLEVETPMLQTL-----AGGAAARPFVTHSNALDIDLYLRIAPELFLKRCIVGGFDRVFELNRVFRNEGS---DSTHSPEFSMLETYQTYGTYDDSALITRELIQEVADEAIGTRGSVYDIDGEWATMEMYSSLSEALGEHAVGNKLTAPTFVKDFPVETTPLHRSIPGVTEKWDLYVRGVELATGYSELNDPVVQRDRFADQARAAAA-EDFLTALEYG-MPPCTGTGMGIDRLLMCLTG-LSIRETVLFP......... 493
33 -45.4004ex5_A mol:protein length:529 Lysine--tRNA ligase  ali model follow..  22  184.RYVDL-TPETRTTFRARTKAIASIRKFMGDADFMEVETPMLHPI-----PGGAAAKPFVTHHNALDMEMFLRIAPELYLKRLIVGGFERVFEINRNFRNEGV---SPRHNPEFTMMEFYAAYTDYRWLMDFTERLIRQAAVDAIQYQGRELDLAQPFHRLTITQAIQKYAPEETAEAQLWEPTFIIDYPIEVSPLSDTVAGITERFELFITGREIANGFSELNDPEDQAARFKKQVEQKDA-ADYIRALEYG-MPPTGGCGIGIDRLVMLLTDSPTIRDVLLFP......... 517
34 -45.2004up7_A mol:protein length:777 LYSINE--TRNA LIGASE  ali model follow..  15  160.RYLDLINPESVKNFVLRTKVVKAVRKYLDDKGFLEVETPILNTIP-----GGATARPFITHHNQLDIQMYMRIAPELYLKELVVGGINRVYEIGRLFRNEGIDQT---HNPEFTTCEFYMAYADYNDIMKMTEELLGNMVKDILEIKDRLMDINNEEDIKMLEKFFKEPIPGEKIPRPLDGPEALTFLKKPLAKYHRSEPELTERFELFILKREIANAYTELNNPIVQRSNFEQQAKDKAADEVFLDAIEHA-FPPTGGWGLGIDRLAMLLADVDNIKEVILFPTMRPEDELE 568
35 -44.4006chd_A mol:protein length:597 Lysine--tRNA ligase  ali model follow..  18  230.RYLDL-NDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNII-----PGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGI---DLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITEGQAYDVDFTPPFRRINMVEELEKALGGEFLEVTCINPTFICDHPQIMSPLHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAA-ENFCTALEYG-LPPTAGWGMGIDRVAMFLTDSNNIKEVLLFP......... 571
36 -26.2004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  22  72...............NYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGK---EHLEEFTMLSFIQMGSGRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMH-------------------------------------------------GDLELSSAVVGPIPLDR----------------------EWGIDKPWIGAGFGLERLLKVKHDFKNIKRA............. 271
37 -25.9005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  22  51...........EERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGK---EHLEEFTMLAFAQMGSGRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMH-------------------------------------------------GDLELSSAVVGPIPLDR----------------------EWGIDKPWIGAGFGLERLLKVKHDFKNIKRA............. 254
38 -25.3002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  17  73.RHLEQ---RTVKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEDHPLFSQVFWLDGKKCLMLAPNLYTLWRLWDKPIRIFEIGTCYRKESQGA---QHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAA---------------------GIREFELVTESSVVYGDTV------------------------------DVMKGDLELASGAMGPHFLDE---------------KWEIFDPWVGLGFGLERLLMIREGTQHVQSMA............ 288
39 -25.0002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  21  72...............NYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRKIFEIGPCYRKESDGK---EHLEEFTMLNFCQMGSGRENLESIITDFLNHL-----------------IDFKIVGDSCMVYGDTL----------------------------------------DVMHGDLELSSAVVGPIPLDR---------------EWGIDKPWIGAGFGLERLLKVKHDFKNIKRA............. 271
40 -23.9004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  20  44.....LQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRVAPNIFNYARKLDR--KIFEIGPCYRKESDGKE---HLEEFTMLNFFQMGSGRENLESIITDFLNHLGIDFKIVGDSCSVYGDTLDVMH-------------------------------------------------GDLELSSAVVGPIPLDR----------------------EWGIDKPWIGAGFGLERLLKVKHDFKNIKRA............. 253
41 -21.1004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  18  68...........EERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLGNYLRKLDRKIFEIGPCYRKESDGK---EHLEEFTMLNFCQ--MGSGCTRENLESIITDFLNHL----------------IDFKIVGDSCMVFGDTLDVMHGDL------------------------------ELSSAVVGPRPLDR----------------------EWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGIST. 283
42 -20.1003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  18  59.....LQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLTPNLYNYLRKLDRKIFEIGPCYRKESDGK---EHLEEFTMLVFWQ--MGSGCTRENLESIITDFLNHLGIDFKIVGD-----SCMVFGDTLDVMHGDL----------------------------------------ELSSALVGPIPLDR----------------------EWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGIST. 280
43 -19.1004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  20  45.....LQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLANYLRKLDRKIFEIGPCYRKESDGKE---HLEEFTMLNFCQ--MGSGCTRENLESIITDFLNHL----------------------------------------------IDFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPIPLDR----------------------EWGIDKPWIGAGFGLERLLKVKHDFKNIKRA............. 254
44 -15.8002rhq_A mol:protein length:294 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  17  50..................TRTVEEIEDLFLGLGYEIVDGYEVEQD-EALNLPKSHPARDMQDSFYITDEILMRTHTSPVQARTMEKRNGKIICPGKVYRRD---SDDATHSHQFTQIEGLVV-IKMSDLKGTLELVAKKLFGADREI--RLRPSYFPFTEPSVEVDVSCFKCKGKGCNVCKHTGWI----------------------------EILGAGMVHPNV------LEMAGFDSNEYSGF-------------AFGMGPDRIAMLKYGIEDIRYF............. 269
45 -15.7003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  12  37..............AKRRRAVETRLLSFVEDAGYEPVTSGLFEYVDTLLRARSPESSRDWIRLDGGGDAVALRPEMTPSIARMAAPRVARWCYCERVYRRTDDPASLSWKAAESTQVGIERSVDVDMDVLRLLHEASAAAVPRLLDALGAFLACLTSGNYVQFRELWQLHAAKDVDLLANLLTWSPAERDAAKRSREASDRELEALLRDAVDPRAAADVRDAWRYLCRLAEALHDSGLASDELDYYTGLAQFGAGAPAVGFAFEVERVMAVLEAQEEGEGEC............ 373
46 -15.2001b70_A mol:protein length:350 PHENYLALANYL-TRNA SYNTHETASE  ali model follow..  13  104..................TLMERELVEIFRALGYQAVEGPEVESEFFNFDAHPARDMWDTFWLTGEGFRLEGPLGEEVEGRLLLRTHTSRIVVPGRVFRFEQTDA---THEAVFHQLEGLVV-IAMAHLKGAIYELAQALFGPDSK----------------------------------------VRFQPVYFPFVEPGAQFAVWWPEGGKWLELGGAGM--------PKVFQAVDAYRERLGLPPAYRGVTGF----AFGLGVERLAMLRYGIPDIRYF............. 335
47 -14.5004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  13  81..............MAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMN--KRYHIAKVYRRDNPAMTRGRY-REFYQCDFDIPMIPDAECLKIMCEILSSL-RRILDGMFAICGVSDSKTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNALEGLGDLKLLFEYLTLFGIDDRGLDYYTGV-RYDGL-PCVGLSIGVERIFSIV...................... 404
48 -14.3004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  13  28..............MAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMN--KRYHIAKVYRRDNPAMTRGRY-REFYQCDFDIPMIPDAECLKIMCEILSSL-RRILDGMFAICGVSDSKTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNALEGLGDLKLLFEYLTLFGIDDKGLDYYTGV-RYDGL-PCVGLSIGVERIFSIV...................... 351
49 -14.3004p71_C mol:protein length:338 Phenylalanine--tRNA ligase alpha subunit  ali model follow..  16  110..................TRTLERIEQCFSRIGYEVAEGPEVEDD-EALNIPGHHPARAMHDTFYFNANMLLRTHTSPVQVRTMESQQPRIVCPGRVYRCDSDLT----HSPMFHQVEGLLV-VSFADLKGTIEEFLRAFFEKQLE---RFRPSFFPFTEPSAEVDIQCVICSGNGCRVCKQTGWL----------------------------EVMGCGM---------NVLRMSNIDPEKFQGF-------------AFGMGAERLAMLRYGVNDLRLF............. 326
50 -14.2003pco_A mol:protein length:327 Phenylalanyl-tRNA synthetase, alpha subunit  ali model follow..  13  110..................TRTIDRIESFFGELGFTVATGPEIEDD-DALNIPGHHPARADHDTFWFDTTRLLTQTSGVQIRTMKAQQPPIRIIAPGRVYRNDYDQ---THTPMFHQMEGLIV-ISFTNLKGTLHDFLRNFFEEDLQ--------------IRFRPSY---------------------FP------FTEPSAEVDVMGKNGKWLEVLGCGM---------NVLRNVGIDPEVYSGF-------------AFGMGMERLTMLRYGVTDLRSF............. 315
51 -14.2004rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  13  5ARAVRGTKDLFGKELRMHQRIVATARKVLEAAGALELVTPIFEETQVFEKGVGAATDIVRKEMFTFQDRGGRSLTLRPEGTAAMVRAY-RLWMAGPMFRAERPQKGRYR---QFHQVNYEALGSE--EAVVLLYECLKEL--GLRRLKVKLSSVGDPEDRARYNAYLREVLSPHREALSEDSKERLELNPMRILDSKSERDQALLKELGVRPMLDFLGEEARAH-LKEVERHLERLSVPVRGLDYYVRTARYGPRVPGVGFAFGVERVALAL...................... 318
52 -13.8003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  11  37..............MRCRRHLFDVFHATAKTFGFEEYDAPVLESEELYIRKAGEEITEQMFNFITKGGHR-VALRPEMTPSLARLLLGKKWYSIPQCWRYEAITRGRRR---EHYQWNMDIVGVK--ELVCAACWAMRSLAGVTSDKFAPVCVIVDKMEKIPREEVEAQLAVLGLEPTVVDAITTTLSLKS-----------------IDEIAQRVGEEHEAVKELRQFFEQVEAYGYGDRGLAYYTGI-RYDNL-PCAGFGFGDCVIVELL...................... 343
53 -13.5003od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  15  24..............YKTKKNICDQMTEEINLWGYDMIETPTLEYYETVGVVSAILDQQLFKLLDQQGNTLVLRPDMTAPIARLVASSLKRLAYQSNVYRAQQNEGGKPA---EFEQLGVELASADGEVIALMIAGYVNALLMDVVGNEQRADRLRRFLYEKNYVGYREHVKSLNLSTIDKSRLMNLLSLRGGRAAIEEARGLIQTEK-----------GKTALAEMTKLYEVLESYGASELHMSYYTGLSKFHRPAQATGFGVRIDLLVEAL...................... 327
54 -13.5003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  15  26..............KRLELYLLDTIRRVYESYGFTPIETPAVER-LEVLQAKGNQGDNIIYGLEPILPPNRQAEKDKSGDTGSEARALKARYQMDVVFRGERAKDGRFR---QFRQCDIDVSLLYDAQMPAIITEIFRKVLTGFFQSLNSETQIKSCISIIDNLEKIGEAKVKLELEKEGINPEQTQKIIDFVKIDGSVDDVLDKLKHLSQTLPESEQFNLGVSELETVITGVRNLGVPDKRFCIDLAIAR-GEKMPGVGISIGLTRLISRLLKAGILNTL............. 367
55 -13.3001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  12  20..............MDVEKFIFKTAEEAAEAFGFRRIDFPSLEYLDLYRIKSGEELLQQTYSFVDKGGRE-VTLIPEATPSTVRMVTSRRWYSFPKVWRYEEPQAGRYR---EHYQFNADIFGSD--EVIALASSILDRL-RKIMEEIIGGMTSSDPFSVFSIIDRYHKISREEFVDQ-------LRSAGIGEDGVSMIADLCSGTRGIDEMARITGKSSEEIARMAAVEDLLASYGVKVRGLSYYTGI-RYGESVPAVGFGMGDAVISLLL...................... 321
56 -13.3005e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  13  6IVAIKGFNDVLPTQTAAWRRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRAIGDATDIVEKEMYTFFDKGNPPESLTLRPEGTAGCV--RVWYMGPMFRYEKPQKGRYR---QFHQFGVETFGVA--ELIMLTARLWKRM--GVDHMVQLELNTLGETDRTEYRNALVAFLNEHKDALDEDSQRRLTTNPLRILDSKIESTQK-----ILENAPKLHDKEDSLSHFQQLQDYLTAAGIKVRGLDYYNKTVRYDGL-PAVGFAMGMERLLLLL...................... 322
57 -13.1001qe0_A mol:protein length:420 Histidine--tRNA ligase  ali model follow..  12  2IKIPRGTQDILPEDSKKWRYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSTDVVQKEMYTFKDKGDRSITLRPEGTAAVVRSY-KLYYNGPMFRYERKQKGRYR---QFNQFGVEAIGAE--EVLAMVMHIYQSF--GLKHLKLVINSVGDMASRKEYNEALVKHFEPVIHEFCSDCQSRLHTDPMRILD--CKVDRDKEAIKTAPRITDFLNEESKAY-YEQVKAYLDDLGIPVRGLDYYTHTARYGPSETGIGFALSIERLLLAL...................... 317
58 -13.1002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  18  12IQAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQT--PLFKRAIGEVTDVVEKEMYTFEDRNGDSLTLRPEGTAGCV--RLWYIGPMFRHERPQKGRYR---QFHQLGCEVFGLQ--ELIMLTARWWRAL--GISEHVTLELNSIGSLERANYRDALVAFLEQHKEKLDEDCKRRMYTNPLRVLDSKNPEVQA-----LLNDAPALGDDEESREHFAGLCKLLESAGIAVRGLDYYNRTVRYGRATPAVGFAMGLERLVLLV...................... 323
59 -12.7006FTT Entity 1(prereleased)  ali follow..  10  15..............AHKQEVLRHQLTQQLITHGYQLVSPPMIEFTESLLSGASEDLKRQTFKIIDQLTGRLMGIRADITPQILRIDAHHRYCYAGDVIHTLPSGLFGSR---TPLQLGAEISIAADIELIDVLFSMINSLFKRLAELAALSASDTEQLMQLYANKNLPELKQVCQVLPMGSDFYTLARFGHDIANLLGRLSENAQQDTKIVTAID---------ELQRLKAHLQVQWQCASGYHYHTGIVRFNQPRQATGFSMDVSRLLAHT...................... 319
60 -12.7005m8h_A mol:protein length:388 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  10  15..............AHKQEVLRHQLTQQLITHGYQLVSPPMIEFTESLLSGASEDLKRQTFKIIDQLTGRLMGIRADITPQILRIDAHHRYCYAGDVIHTLPSGLFGSR---TPLQLGAEISIAADIELIDVLFSMINSLFKRLAELAALSASDTEQLMQLYANKNLPELKQVCQVLPMGSDFYTLARFGHDIANLLGRLSENAQQDTKIVTAID---------ELQRLKAHLQVQWQCASGYHYHTGIVRFNQPRQATGFSMDVSRLLAHT...................... 319
61 -12.7003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  12  37..............MRLRKYLFDVFHSTARKFGFEEYDSPVLESEELYIRKAGEEITEQMFNFITKGGHR-VALRPEMTPSLARQLLAKKWYSIPQCWRYEAITRGRRR---EHYQWNMDIIGVK--ELVCAACTAMQSLAGVSADKFAPVCVIVDKMEKLPREEVVAQLAAIGLESNVVDAITSTLSLKT-----------------IDEIAQRIGEEHEAVRELRDFITQIEAYGFGDRGLAYYTGI-RYDNL-PCVGFGFGDCVIVELL...................... 343
62 -12.4003l4g_A mol:protein length:508 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  12  228..................LKVRSQFRQIFLEMGFTEMPTDNFIESSDALFQPQQHPARDQHDTFFLRDPAEALQLPMDYVQRVKRTHSQKYFSIDRVFRNE---TLDATHLAEFHQIEGVVA-LTLGHLMGVLREFFTKLGIT-------------------------------------------LRFKPAYNPYTEPSMEVFSYHQGLKKWVEVGNSGV---------EMLLPMGLPENVSVI--------------AWGLSLERPTMIKYGINNIREL............. 477
63 -12.2004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  14  26LTGVKGMNDILPQDAGLWEFFEATVKSLLRAYGYQNIRTPIVEHT--PLFTRGIGEVTDIVEKEMYGENLTLRPENTAAVVRAAIEH--RLWYIGPMFRHERPQRGRYR---QFHQVGVEALGFA--EIVMMCQRLWEDL--GLTGIKLEINSLGLAEERAAHRVELIKY-DDDAQRRLYTNPLRVLDTKNPALQEIVRNAPKLIDFL----------GDVSRAHFEGLQRLLKANNVPVRGLDYYNLT-RYGKPTAACGWAMGIERILELL...................... 337
64 -11.7001z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  11  30..............VKSLRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGKTFNQEKMFQFIKHESITLRYDFTLPLVRLYS--RYSYFGKIFRKEKRHKGRST---ENYQIGIELADKSELEILSLALQVIEQLFQRLCQLADGSTELLTELLLKKDLSGLNAFIEKNNFSKELRGLLKEIFITNELSRLENLVTNTKDDVLI--------------SSFDQLKEFSEKLSMIKPKMDYYTDLSNFQEEAFAIGFCCHMDTILKAL...................... 328
65 -11.6002du3_A mol:protein length:534 O-phosphoseryl-tRNA synthetase  ali model follow..  12  118..............ITKREVDSKPLQEIFHRYKKGEIDGDDLSYLIAEVLDVDDITAVKILDEVFPEFKELKPISSTLTLRSHMTTG--KLFSIDRCFRREQGEDAT--RLYTYFSASCVLV-LSVDDGKAVAEALLRQFGFENFR----------------------------------------FRKDEKRSKYYIPDT-----------------------QTEVFAFHPKLVGSSTKYSDGWIEIATFGIYSPTANLGLGVERLAMILYGYDDVRKM............. 346
66 -10.7004h2w_A mol:protein length:346 Amino acid--[acyl-carrier-protein] ligase 1  ali model follow..  56............LYESIVERLAALITS-HREAGTEALRFPPVMSRAQLEKSGYLKSAGGDWTTSLSPADLVLSPAPIAASRGPLPKGGLRFDVAADCFRREPSKH---DRLQSFRMREY-VCIGTPDDVSDFRERWMVRA-----------------------QAIARDLGLTFRVDY-ASDPFFGRAGKMLANNQRDQQLKFELLIPLRSEEQPTACMSFNYHR-EHFGTTWGIQDANGEPAH-------------TGCVAFGMDRLAVAMFHTHGT-DLSAWPA........ 318
67 -10.7005x6c_A mol:protein length:553 O-phosphoserine--tRNA(Cys) ligase  ali model follow..  14  133..................GIDIDEEKKERLREVLHLYKKGAIDGDD-KALNVSNEMGLKVLETAFPEFKDLKPESTTLTLRSHMTSG--KLFSIDRCFRREQREDRS--HLMSYHSASCVVV-VSVDDGKVVAEGLLAQFGFTKFK----------------------------------------FKPDEKKSKYYTPETQTEVYAYHPKLGEEVATFGV---------IALAKYNIDVPVM----------------NLGLGVERLAMIIYGYEDVRAM............. 354
68 -10.2003mey_A mol:protein length:346 Bll0957 protein  ali model follow..  10  55...........ALYESIVERLAALITS-HREAGTEALRFPPVMSRACGLHGTEREINAAVSRFDAGGDWTTSLSPADLVLSPAACYPVYPIAAAADCFRREPSKH---DRLQSFRMREY-VCIGTPDDVSDFRERWMVRA-----------------------QAIARDLGLTFRVDY-ASDPFFGRVGQMKAVSQKQQQLKFELLIPLRSEEQPTACMSFNYHR-EHFGTTWGIQDANGEPAH-------------TGCVAFGMDRLAVAMFHTHG--DLSAWPA........ 318
69 -10.2001usy_A mol:protein length:275 ATP PHOSPHORIBOSYLTRANSFERASE REGULATORY SUBUNIT  ali model follow..  4................LDFEKVFSFYSKATKKGFSPFFVPALEKAEEPAGNFFLDRKGNLFSIREDFTKTVLNHRKRYSPDSQI-----KVWYADFVYRYSGSDLV------AEYQLGLEKSLDDSLEVLEIIVESASEFFEGPVIVEIGHTGVYEDLLKEIPKDLHEKVLNLIDTKNLAEIEFLSHMKKID-----LSRVEKIIEDSIYRRSPEHLKTMDLPEDLLSASSFLQEKFPTVRTIEEYCGLIEYTVNEKGVGGSIFLEGKT......................... 274
70 -10.0002cim_A mol:protein length:522 SERYL-TRNA SYNTHETASE  ali model follow..  11  225..............ARIFRTFEKIVLEELLEPGYREMIFPKLVTWEADYYKVTHEVPTKLIKEKIAEPIGGMCYAQCPPFWMYVAGET-KVFDRGTSHRYESGGIHGIERVDEFHRIEI-VWIGTKEEVLKCAEELHDRYMHIFNDILDIEWRKAR------------------------VTPWFMAQEGLLGLAEENTVGTTDYEACLPYRGPD----------------EFQNVSINGDKYPKGFNVKLQSGDELWSGSGVGLERWAAVFLAQKG--DPANWPE........ 500
71 -9.9703w3s_A mol:protein length:527 Type-2 serine--tRNA ligase  ali model follow..  14  219...........PPMAALFEVLRDFLLERVTRKGFEPALFPKLIPLETYVWGELNERTLGSLKEKLRDPGYVLAPAQCEPFYELLRDEIKLYDCSGWTYRWEGGAAKGLERVNEFQRIEH-VWIAEPEEAYRIRRELLEAT-----------------------KRVAEELELEWKVVV-SDDPFYLEGRLLEDRDIELPDVPSYEFEVYLPFKGERSSEEAWI--------SVGSFNVHGEHFVDGFNVKEKSGRTLFTGAGLGVTRWVVGLLGLPEVPKTLTWPE........ 527
72 -9.6403qne_A mol:protein length:485 Seryl-tRNA synthetase, cytoplasmic  ali model follow..  10  185..............VFLNQALINYGLSFLSSKGYVPLQAPMMNKEVMAKTAQLSQFDEELYKVIDGEDEKYLIATSEYHAGEWFESPAERYAGYSSCFRREAGSHGKDAWVHAFEKIEQEKSWEEFDRMIGCSEEFYQSL--------------------LPY-RVVGIVSGELNNAAAKKYDLEA--FPFQ-------------------EYKELVSSNCTDYQSRNLEIRCGIKQQNQQEKKY---------VHCLNSTLSATERTICCILENYQKEDGLVIPE........ 429
73 -9.5203lsq_A mol:protein length:484 Seryl-tRNA synthetase  ali model follow..  14  205...........GGLVQLQVALVSYSLDFLVKRGYTPFYPPFLNRDVMGEVAQLSQFDEELYQVSGDGDKKYLIATSEYHRGRWFTEL--KYAGMSTCFRKEAGAHGRDTRVHQFDKIEQEESWRHLEDMITTSEEFNKSL--------------------LPY-RVVNICSGALNNAAAKKYDLEA--FPAS-------------------AFRELVSCSSQSVNCRYGPNLRGTAAQNVKEYCHMLN-----------GTLCAITRTMCCICENYQTEEGVVIPD........ 455
74 -9.1602i4l_A mol:protein length:458 Proline-tRNA ligase  ali model follow..  12  61..............HRVLKKIEQIVREEQNRAGAIELLMPTLQLAD-RESGRYDAYGPEMLRIADRHKRELFRAYIKSYKSLPL-----NLYHIQWKFRDEQRPRFGVMRGREFLMKDAYSFDVDEAGARKSYNKMFVAYLRTFARMGLKAIPMRAETGPIGGDLSHEFIVLAETGESGVENVDYDGDLTPIIKQWTSVYAATEDVHEPARYESEVPEANRLNTRGIEVGQIFYFGTKYSDSMK-VTGPDGTDAPIHGGSYGVGVSRLLGAIIEACHDDNGIIWPEAPFRVTIL 365

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 8 2 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Rychlewski L, Zhang B, Godzik A. Fold predictions for bacterial genomes. J Struct Biol. 2001 May-Jun;134(2-3):219-31. Review.