current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 1nnx_A mol:protein length:109 Protein ygiW, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
2 -22.6003nbh_B mol:protein length:147 RecQ-mediated genome instability protein 2  ali model follow..  15  1..GPLGSDSFSGGPAGVRLPRSPPLVLAEQLRRDAEGAAVWMQGRVVM-ADRGEARLRDPSGDFSVRGERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLS. 126
3 -21.8003mxn_B mol:protein length:150 RecQ-mediated genome instability protein 2  ali model follow..  14  1..GSHMAAAADSFSGGPAGVRLPRSVLAEQLRRDAEGAAVWMQGRVVM-ADRGEARLRDPSGDFSVRGERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLS. 129
5 -19.0003kf6_A mol:protein length:159 Protein stn1  ali model follow..  14  21.........................MFISDVHKISF-RWIQIVGYIAAIDIYEGLTVDDCSGMVLRDDFSMSKRAISMSPGNVVCVFGKINSFRSEVELIAQSFEELR. 127
6 -18.4004joi_A mol:protein length:166 CST complex subunit STN1  ali model follow..  18  11.........................LYIRDILDMKESKQVDVLGTVIGVRERDAYGVDDSTGVINCICQETIEQKTKIEIGDTIRVRGSIRTYREEREIHATTYYKVD. 138
7 -18.2004gnx_B mol:protein length:136 Putative uncharacterized protein  ali model follow..  14  5..................GNNTLRPVTIRQILNAEQPGQLTFVAVVRNISRNATYSVEDGTGQIEVSSSDDSSKASEIRNNVYVRVLGTLKSFQNRRSISSGHMRPVI. 115
8 -15.8003kf8_A mol:protein length:220 Protein stn1  ali model follow..  18  86.....................................NQINIFGKIVYEQYKEKLVISDFIGIDSKQFKEVGLTLDKKNYGKIVELEGEIYNWYDSINVSKKPDRELK. 175
9 -15.2004gla_C mol:protein length:109 OBody NL8  ali model follow..  19  10..........................WTAEITPNLHGTEVVVAGWVASLGDYGRVKISDREGGAAVPVYLEA---AELSREDVVVIKGIVKGVGRGVEIFPSEIWILNK 106
10 -14.9004glv_B mol:protein length:107 OBody AM3L09  ali model follow..  19  8..........................WTAEITPNLHGSEVVVAGWVAHLGDYGRVKISDREGGAAVPVYLERGK-AELSREDVVVIKGIVTRWDTGVEIFPSEIWILNK 106
11 -14.8001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  15  3.......................EKVYCQEVKPELDGKKVRLAGWVNMRVGKKIFLIRDSTGIVQAVVAKNVVGEKKLGRESSVIVEGIVERAPGGAEVHVEKLEVIQA 100
12 -14.8004gn5_A mol:protein length:113 OBody AM3L15  ali model follow..  19  8..........................WTAEITPNLHGSEVVVAGWVAHLGDYGRVKISDREGGAAVPVYLERGK-AELSREDVVVIKGIVEAG-TGVEIFPSEIWILNK 106
13 -14.5004gn4_B mol:protein length:108 OBody AM2EP06  ali model follow..  19  9..........................WTAEITPNLHGSEVVVAGWVAHLGDYGRVKISDREGGAAVPVYLERGK-AELSREDVVVIKGIVYGSATGVEIFPSEIWILNK 107
14 -14.5005gro_A mol:protein length:115 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  16  7.......................RSHFCTEISEKDVGKIVKVAGWCNTYRDHGGVVFRDKSGLVQLVCDPSS-KALEVRSEFVLVAKGKVKLKTGKIEIVLEELIIENK 108
16 -14.3004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  12  50...............QSQEKPDRVLVRVRDLTIQKADEVVWVRARVSRAKGKQCFLLRQQQFNVQALVAVGDHASKQINKESIVDVEGVVSCTQQDVELHVQKIYVISL 161
17 -14.3004jbj_A mol:protein length:198 Interferon-activable protein 202  ali model follow..  11  92.....AAPNQMFEVPKNIIRSAKETLKISKIKELDSGTLIYGVFAVEKKKVNDKFKIKDNEDNIKVVWDKEQ-HNINYEKGDKLQLFSHLRKGNGKPILHSGNHSFIK. 197
19 -14.0001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  13  2......................YRSHFIADVTPEYDGKEVIWAGWVLRDLGGKKFILRDKTGLGQVVVDKNS---QELTQESVIQVRGIVKRAPRGIELHAEEITLLSK 97
20 -13.9003e0e_A mol:protein length:97 Replication protein A  ali model follow..  19  2...........................NYKISELMPNLSGTINAEVVTAYPKKEFFLKDDTGSIRGTLWNEL--DFEVKKGDIAEVSGYVKQGYSGLEISVDNIGIIEK 95
21 -13.9004gn3_B mol:protein length:113 OBody AM1L10  ali model follow..  20  12..........................WTAEITPNLHGTEVVVAGWVASLGDYGRVKISDREGGAAVSVYLEYGK-AELSREDVVVIKGIVADMHNGVEIFPSEIWILNK 111
22 -13.9004l5t_A mol:protein length:203 Interferon-activable protein 202  ali model follow..  11  108.....................PIEHLKICDLHLQTEERLVDGEFKVYRKSSGNNYGIWDDTGAMKVVVSGQL-TSVNCEIGNTIRLVCELTSNADEWFLRASYMEVIMP 201
23 -13.4004lnq_A mol:protein length:197 Interferon-activable protein 202  ali model follow..  11  88.....AAPNQMFEVPKNIIRSAKETLKISKIKELDSGTLIYGVFAVEKKKVNDKFKIKDNEDNIKVVWDKEQ-HNINYEKGDKLQLFSHLRKGNGKPILHSGNHSFIK. 193
24 -13.4002k5v_A mol:protein length:104 Replication protein A  ali model follow..  20  4.............................KISELMPNLSGTINAEVVAAYPKKEFFLKDDTGSIRGTLWNEL--DFEVKKGDIAEVSGYVKQGYSGLEISVDNIGIIE. 94
25 -13.2003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  17  44..................YKTGLKYTEIEELVPAMAEKTVTIRARVVRGKGNMVFLLRKGIYTCQALVMKSETISKEISAESICDITGIVKATQQDVEIHVTSIAVVSL 152
27 -12.9003dm3_A mol:protein length:105 Replication factor A  ali model follow..  14  1.......................EIKDTYNIGELSPGMTATFEGEVISALPIKEFIVRDETGSIRVTLWDNL--DIDVGRGDYVRVRGIREGYYGGLECTANYVEILK. 98
28 -12.8004l5q_A mol:protein length:199 Interferon-activable protein 202  ali model follow..  11  92.....AAPNQMFEVPKNIIRSAKETLKISKIKELDSGTLIYGVFAVEKKKVNDKFKIKDNEDNIKVVWDKEQ-HNINYEKGDKLQLFSHLRKGNGKPILHSGNHSFIK. 197
30 -12.3005xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  11  28....................PEPKCVKIGALEGY-RGQRVKVFGWVHRLRRQGKLVLRDGTGYLQCVLADELCQCVLLSTESSVAVYGMLKQAPGGHELSCDFWELIGL 128
31 -12.3004wj3_M mol:protein length:599 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  23  5.......................RSHYCGQLNESLDGQEVTLCGWVHRRRDHGGVIFRDREGLAQVVFDPDRAETDRVRSEFVVKITGKVNMASGSIEVLGYELEVLNQ 107
32 -12.2003rn2_A mol:protein length:208 Interferon-inducible protein AIM2  ali model follow..  10  106....................KAGETPKINTLQTQPLGTIVNGLFVVQKVTEKKKFDLSDNTGKMEVLGVRNE-DTMKCKEGDKVRLTFTLSKNGEKLQLTSGVHSTIK. 196
33 -12.1001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  19  3.........................VLVRDLKAH-VGQEVELLGFLRRDLGRIQFLLRDRSGVVQVVTGGL----KLPLPESALRVRGLVAKAPGGLEVQAKEVEVLSP 87
35 -11.8003kf6_B mol:protein length:105 Protein ten1  ali model follow..  11  5....................DSAKLIFINQINDCKDGQKLRFLGCVQS-YKNGILRLIDGSSSVTCDVT--VLPDVSIQKHEWLNIVGRKRQDGIVDVLLIRSAVGIN. 90
36 -11.6003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  20  1......GPGSMMTEATTTPVETPIVCNIRDAAGL-EGKLVTFKGWAYHIRKARKVELRDGSGYCQCVIFGKELCEKLLTRECSLEITGRLIADILNLEMQVTEWKVIGE 121
38 -11.5005w25_A mol:protein length:616 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  17  19.......................RSHAAGLLREGDAGQQVTLAGWVARRRDHGGVIFRDASGIAQVVFRDPQDTEHRLRAEFCVSVAGVVEIATGEIEVNATSLTVLGE 122
39 -11.3005vbn_A mol:protein length:527 DNA polymerase epsilon subunit 2  ali model follow..  16  174................................STTKIGDAIVLGMITQL-KEGKFFLEDPTGTVQLDLSKAQFHSGLYTEACFVLAEGWFEDQ----VFHVNAF..... 240
41 -11.0003au7_A mol:protein length:402 Putative uncharacterized protein  ali model follow..  16  260..................HATDMHLIGEEEVHRLENYRSYRLRGRVTLE-GHVFFEIDTKFGSVKCAAFEPTKQ-RLLRKGDVVEVYGSMKKD----TINLEKIQIVE. 354
42 -10.9002kbn_A mol:protein length:109 Conserved protein  ali model follow..  10  2.....................EPQLTKIVDIV--ENGQWANLKAKVIQLWENTVGLLGDETGIIKFTIWKNA-ELPLLEQGESYLLRSVVGEYNDRFQVQVNKNSSIEK 93
43 -10.8004rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  18  3.......................RTHAAGSLRPADAGQTVTLAGWVARRRDHGGVIFRDASGVSQVVFREGDVLAARLRAEFCVAVTGVVEIPTGQIEVNATELTVLGE 103
44 -10.6002k50_A mol:protein length:115 Replication factor A related protein  ali model follow..  10  6..........................RMDTISKLEEGAETPVTGRVMKISSPRTFIIADDTGELRAVFTENIKLLKKFREGDVIRIKD--GGFGGRKEAHLMPRSTVE. 103
45 -10.6004o2d_A mol:protein length:620 Aspartate--tRNA ligase  ali model follow..  18  19.......................RTHAAGSLRPADAGQTVTLAGWVARRRDHGGVIFRDASGVSQVVFREGDVLAARLRAEFCVAVTGVVEIPTGQIEVNATELTVLGE 119
46 -10.4002oq0_A mol:protein length:206 Gamma-interferon-inducible protein Ifi-16  ali model follow..  111.....................AKETLKIDILHKQASG--NIVYGVFMLHKKTVNYEIQDDRGKMDVVG--GQCHNIPCEEGDKLQLFCRLRKKNQMSKLISSFIQIKKK 204
47 -10.3005d8e_A mol:protein length:115 SOSS complex subunit B1  ali model follow..  15  2......................TTETFVKDIKPGLKN--LNLIFIVLETGRVTTCKVADKTGSINISVWDDVGN--LIQPGDIIRMTGYASVFKGCLTLYTGRGGDLQ. 93
48 -10.0001wjj_A mol:protein length:145 hypothetical protein F20O9.120  ali model follow..  15  1.........GSSGSSGSTVKRKPVFVKVEQLKPGTTG--HTLTVKVIEANIVVPVLIGDETGCILFTARNDQ---DLMKPGATVILRSRIDMFKGTMRLGVDKWGRIE. 118
51 -9.8502mna_A mol:protein length:117 Single-stranded DNA binding protein (SSB)  ali model follow..  13  3.........................EKVGNLKPNMES--VNVTVRVLEASEARQIIVGDETGRVKLTLWGKHAG--SIKEGQVVKIEAWTTAFKGQVQLNAGSKTKIAE 95
52 -9.7503f1z_A mol:protein length:133 putative nucleic acid-binding lipoprotein  ali model follow..  14  5...AFYSAGDKLFQPGDDAVASMQTYSVAQFLQP-LGKWVKVRGVIVDIAGSYYFIVTMRDKRLTFNFGSHNSADEALSNGSVATIVGQVHQVQDSTIPTLQNPKVVK. 133
53 -9.6602k75_A mol:protein length:106 uncharacterized protein Ta0387  ali model follow..  12  1......................SDLVKIRDVS--LSTPYVSVIGKITGIHKKEQGYIEDDTARIRISSFGK-----QLQDSDVVRIDARVAQFNGYLSLSVGDSSRIES 92
54 -9.4904joi_D mol:protein length:122 CST complex subunit TEN1  ali model follow..  10  4....................KPGTYYLPWEVSAVPDGSTLRTFGRLCLDMIQSRVTLMAQHGSHQVLVCTKLVEPFHAQVGSLYIVLGELQHQDRGSVVKARVLTCVE. 97
55 -9.3604owt_B mol:protein length:211 SOSS complex subunit B1  ali model follow..  14  2......................TTETFVKDIKPGLKN--LNLIFIVLETGRVTTCKVADKTGSINISVWDDV--GNLIQPGDIIRLTGYASVFKGCLTLYTGRGGDLQK 94
56 -9.0704ywk_A mol:protein length:206 Cell division control protein 21  ali model follow..  13  100......................PETLMVKDIGAEHINKLIQVEGIVTRVGPFQSFRIQDRPEFIDGILLDDIVD--VALPGDRVIVTGILRVVLEKRELEVNHIEPVS. 203
59 -9.0204ex5_A mol:protein length:529 Lysine--tRNA ligase  ali model follow..  14  70..........................DADKEALEAKSLEVAIAGRMMLKRVMGKASFQDGSGQIQFFVTPADVGAKKWDLGDIVAARGVLRTNKGELSVKCTQLRLLAK 162

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 6 6 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Rychlewski L, Ye Y, Jaroszewski L, Godzik A. Integrated web service for improving alignment quality based on segments comparison. BMC Bioinformatics. 2004 Jul 22;5(1):98.